Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	84164
Gene name Gene Name - the full gene name approved by the HGNC.	Activating signal cointegrator 1 complex subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ASCC2
Synonyms (NCBI Gene) Gene synonyms aliases	ASC1p100, p100
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.2

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022446	hsa-miR-124-3p	Microarray	18668037
MIRT050191	hsa-miR-26a-5p	CLASH	23622248
MIRT044724	hsa-miR-320a	CLASH	23622248
MIRT042189	hsa-miR-484	CLASH	23622248
MIRT1936987	hsa-miR-1207-3p	CLIP-seq
MIRT1936988	hsa-miR-1275	CLIP-seq
MIRT1936989	hsa-miR-18a	CLIP-seq
MIRT1936990	hsa-miR-18b	CLIP-seq
MIRT1936991	hsa-miR-3124-3p	CLIP-seq
MIRT1936992	hsa-miR-3688-5p	CLIP-seq
MIRT1936993	hsa-miR-4271	CLIP-seq
MIRT1936994	hsa-miR-4320	CLIP-seq
MIRT1936995	hsa-miR-4327	CLIP-seq
MIRT1936996	hsa-miR-4525	CLIP-seq
MIRT1936997	hsa-miR-4665-5p	CLIP-seq
MIRT1936998	hsa-miR-4723-5p	CLIP-seq
MIRT1936999	hsa-miR-4725-3p	CLIP-seq
MIRT1937000	hsa-miR-4731-5p	CLIP-seq
MIRT1937001	hsa-miR-4735-3p	CLIP-seq
MIRT1937002	hsa-miR-4747-5p	CLIP-seq
MIRT1937003	hsa-miR-4753-3p	CLIP-seq
MIRT1937004	hsa-miR-4758-3p	CLIP-seq
MIRT1937005	hsa-miR-4763-5p	CLIP-seq
MIRT1937006	hsa-miR-550a	CLIP-seq
MIRT1937007	hsa-miR-625	CLIP-seq
MIRT1937008	hsa-miR-637	CLIP-seq
MIRT2176772	hsa-miR-198	CLIP-seq
MIRT2176773	hsa-miR-3074-5p	CLIP-seq
MIRT2176774	hsa-miR-370	CLIP-seq
MIRT1936993	hsa-miR-4271	CLIP-seq
MIRT2176775	hsa-miR-431	CLIP-seq
MIRT2176776	hsa-miR-4685-5p	CLIP-seq
MIRT2176777	hsa-miR-4711-3p	CLIP-seq
MIRT1936999	hsa-miR-4725-3p	CLIP-seq
MIRT2176778	hsa-miR-4795-5p	CLIP-seq
MIRT2176779	hsa-miR-581	CLIP-seq
MIRT2176780	hsa-miR-626	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	28514442, 29997253, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	12077347, 26924529, 29997253
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006260	Process	DNA replication	NAS	29997253
GO:0006281	Process	DNA repair	IEA
GO:0006307	Process	DNA alkylation repair	NAS	29997253
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	12077347
GO:0006974	Process	DNA damage response	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0022626	Component	Cytosolic ribosome	IDA	36302773
GO:0032790	Process	Ribosome disassembly	IDA	32579943, 36302773
GO:0032790	Process	Ribosome disassembly	NAS	32099016
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043130	Function	Ubiquitin binding	IEA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IDA	36302773
GO:0072344	Process	Rescue of stalled ribosome	IDA	32579943, 36302773
GO:0072344	Process	Rescue of stalled ribosome	IMP	32099016
GO:0180022	Component	RQC-trigger complex	IDA	12077347
GO:1990116	Process	Ribosome-associated ubiquitin-dependent protein catabolic process	IMP	32099016
GO:1990116	Process	Ribosome-associated ubiquitin-dependent protein catabolic process	NAS	32099016
GO:1990391	Component	DNA repair complex	IPI	29997253

MIM	HGNC	e!Ensembl
614216	24103	ENSG00000100325

Protein

UniProt ID

Q9H1I8

Protein name

Activating signal cointegrator 1 complex subunit 2 (ASC-1 complex subunit p100) (Trip4 complex subunit p100)

Protein function

Ubiquitin-binding protein involved in DNA repair and rescue of stalled ribosomes (PubMed:29144457, PubMed:32099016, PubMed:32579943, PubMed:36302773). Plays a role in DNA damage repair as component of the ASCC complex (PubMed:29144457). Recruits

PDB

2DI0 , 6YXQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02845	CUE	468 → 509	CUE domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12077347}.

Sequence

MPALPLDQLQITHKDPKTGKLRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEYLERAT
FVANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLRYVPRKFDEGVASAPEVVDMQKRLH
RSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKGNSPLLQKMI
GNIFTQQPSYYSDLDETLPTILQVFSNILQHCGLQGDGANTTPQKLEERGRLTPSDMPLL
ELKDIVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRLASFYEAAIPEMESAIKKRRLE
DSKLLGDLWQRLSHSRKKLMEIFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQE
KRFLRDYDALFPVAEDISLLQQASSVLDETRTAYILQAVESAWEGVDRRKATDAKDPSVI
EEPNGEPNGVTVTAEAVSQASSHPENSEEEECMGAAAAVGPAMCGVELDSLISQVKDLLP
DLGEGFILACLEYYHYDPEQVINNILEERLAPTLSQLDRNLDREMKPDPTPLLTSRHNVF
QNDEFDVFSRDSVDLSRVHKGKSTRKEENTRSLLNDKRAVAAQRQRYEQYSVVVEEVPLQ
PGESLPYHSVYYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEED
DDDEEDDADEEAPKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQS
RETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS

Sequence length

757

Interactions

View interactions

	Reactome
			ALKBH3 mediated reversal of alkylation damage

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dental caries	Dental caries	N/A	N/A	GWAS
Diabetes	Type 2 diabetes (adjusted for BMI), Type 2 diabetes	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG)	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Coronary Artery Disease	Associate	33686958
Myoepithelioma	Associate	36577525
Neoplasms	Associate	33139697, 36577525

ASCC2 (activating signal cointegrator 1 complex subunit 2)