Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8409
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitously expressed prefoldin like chaperone
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UXT
Synonyms (NCBI Gene) Gene synonyms aliases	ART-27, SKP2, STAP1
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alterna

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029970	hsa-miR-26b-5p	Microarray	19088304
MIRT031877	hsa-miR-16-5p	Proteomics	18668040
MIRT047919	hsa-miR-30c-5p	CLASH	23622248
MIRT045646	hsa-miR-149-5p	CLASH	23622248

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
CREB1	Activation	17761951

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21730289
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	16221885
GO:0000785	Component	Chromatin	IBA	21873635
GO:0000922	Component	Spindle pole	IEA
GO:0000930	Component	Gamma-tubulin complex	IDA	16221885
GO:0003682	Function	Chromatin binding	IDA	21730289
GO:0003712	Function	Transcription coregulator activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	IDA	21730289
GO:0005515	Function	Protein binding	IPI	12762840, 16221885, 17620405, 17635584, 20864032, 21730289, 24021647, 25036637, 25416956, 28106301, 28514442, 31515488, 32296183
GO:0005634	Component	Nucleus	IDA	12762840, 21730289
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	21730289
GO:0005813	Component	Centrosome	IDA	16221885
GO:0005856	Component	Cytoskeleton	IDA	12762840
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006915	Process	Apoptotic process	IEA
GO:0007098	Process	Centrosome cycle	IMP	16221885
GO:0008017	Function	Microtubule binding	TAS	12762840
GO:0047497	Process	Mitochondrion transport along microtubule	TAS	12762840
GO:0048487	Function	Beta-tubulin binding	IDA	12762840
GO:0051015	Function	Actin filament binding	IDA	12762840
GO:0070317	Process	Negative regulation of G0 to G1 transition	TAS

MIM	HGNC	e!Ensembl
300234	12641	ENSG00000126756

Protein

UniProt ID

Q9UBK9

Protein name

Protein UXT (Androgen receptor trapped clone 27 protein) (ART-27) (Ubiquitously expressed transcript protein)

Protein function

Involved in gene transcription regulation (PubMed:21730289, PubMed:28106301). Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription (PubMed:11854421, PubMed:21730289). Together with URI1, associates wi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02996	Prefoldin	28 → 148	Prefoldin subunit	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous (PubMed:10087202, PubMed:11827465, PubMed:11854421, PubMed:17635584). Expressed in prostate epithelial cells (PubMed:21730289). Expressed in mammary epithelial cells (PubMed:28106301). Highest levels in the heart, skeletal m

Sequence

MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQ
EAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTEL
SNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH

Sequence length

157

Interactions

View interactions

	Reactome
			Transcriptional Regulation by E2F6

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19318562

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinogenesis	Associate	16221885, 31481081
Carcinoma Hepatocellular	Associate	35217267
Carcinoma Renal Cell	Associate	31481081
Kidney Neoplasms	Associate	31481081
Mental Retardation X Linked	Associate	21668950
Neoplasm Metastasis	Stimulate	31481081
Neoplasms	Stimulate	16221885
Neoplasms	Associate	31481081

UXT (ubiquitously expressed prefoldin like chaperone)