UXT (ubiquitously expressed prefoldin like chaperone)

Gene

• Entrez ID: 8409
• Gene name: Ubiquitously expressed prefoldin like chaperone
• Gene symbol: UXT
• Synonyms (NCBI Gene): ART-27, SKP2, STAP1
• Chromosome: X
• Chromosome location: Xp11.23
• Summary: The protein encoded by this gene functions as a cofactor that modulates androgen receptor-dependent transcription, and also plays a critical role in tumor necrosis factor-induced apoptosis. Expression of this gene may play a role in tumorigenesis. Alterna

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029970	hsa-miR-26b-5p	Microarray	19088304
MIRT031877	hsa-miR-16-5p	Proteomics	18668040
MIRT047919	hsa-miR-30c-5p	CLASH	23622248
MIRT045646	hsa-miR-149-5p	CLASH	23622248

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Activation	17761951

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21730289
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	16221885
GO:0000785	Component	Chromatin	IBA
GO:0000922	Component	Spindle pole	IEA
GO:0003682	Function	Chromatin binding	IDA	21730289
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	21730289
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	12762840, 16221885, 17620405, 17635584, 20864032, 21730289, 24021647, 25036637, 25416956, 28106301, 28514442, 31515488, 32296183, 33961781, 37608570
GO:0005634	Component	Nucleus	IDA	12762840, 21730289
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	21730289
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	16221885
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IDA	12762840
GO:0005856	Component	Cytoskeleton	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007098	Process	Centrosome cycle	IMP	16221885
GO:0008017	Function	Microtubule binding	TAS	12762840
GO:0016592	Component	Mediator complex	IBA
GO:0032991	Component	Protein-containing complex	IEA
GO:0047497	Process	Mitochondrion transport along microtubule	TAS	12762840
GO:0048487	Function	Beta-tubulin binding	IDA	12762840
GO:0050821	Process	Protein stabilization	NAS	29662061, 31738558
GO:0051015	Function	Actin filament binding	IDA	12762840
GO:0101031	Component	Protein folding chaperone complex	NAS	29662061
GO:1990062	Component	RPAP3/R2TP/prefoldin-like complex	IPI	31738558

Other IDs

• MIM: 300234
• HGNC: 12641
• e!Ensembl: ENSG00000126756

Protein

• UniProt ID: Q9UBK9
• Protein name: Protein UXT (Androgen receptor trapped clone 27 protein) (ART-27) (Ubiquitously expressed transcript protein)
• Protein function: Involved in gene transcription regulation (PubMed:21730289, PubMed:28106301). Acts in concert with the corepressor URI1 to regulate androgen receptor AR-mediated transcription (PubMed:11854421, PubMed:21730289). Together with URI1, associates wi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02996	Prefoldin	28 → 148	Prefoldin subunit	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous (PubMed:10087202, PubMed:11827465, PubMed:11854421, PubMed:17635584). Expressed in prostate epithelial cells (PubMed:21730289). Expressed in mammary epithelial cells (PubMed:28106301). Highest levels in the heart, skeletal m
• Sequence:

  MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQ
  EAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTEL
  SNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH

• Sequence length: 157

Pathways

Reactome:

Transcriptional Regulation by E2F6