Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	840
Gene name Gene Name - the full gene name approved by the HGNC.	Caspase 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CASP7
Synonyms (NCBI Gene) Gene synonyms aliases	CASP-7, CMH-1, ICE-LAP3, LICE2, MCH3
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing

Show/Hide all(173)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020444	hsa-miR-106b-5p	Microarray	17242205
MIRT021838	hsa-miR-132-3p	Microarray	17612493
MIRT023343	hsa-miR-122-5p	Microarray	17612493
MIRT024257	hsa-miR-215-5p	Microarray	19074876
MIRT024257	hsa-miR-215-5p	Microarray	19074876
MIRT026826	hsa-miR-192-5p	Microarray	19074876
MIRT030234	hsa-miR-26b-5p	Microarray	19088304
MIRT042101	hsa-miR-484	CLASH	23622248
MIRT053388	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	23807165
MIRT053388	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	23807165
MIRT020444	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22986525
MIRT020444	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22986525
MIRT020444	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22986525
MIRT020444	hsa-miR-106b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22986525
MIRT731813	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27449900
MIRT731813	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27449900
MIRT732066	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Western blot	26307684
MIRT732066	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Western blot	26307684
MIRT732066	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Western blot	26307684
MIRT735408	hsa-miR-371b-5p	Luciferase reporter assay, Western blotting, Microarray	32951155
MIRT864129	hsa-miR-1236	CLIP-seq
MIRT864130	hsa-miR-4659a-5p	CLIP-seq
MIRT864131	hsa-miR-4659b-5p	CLIP-seq
MIRT864132	hsa-miR-4698	CLIP-seq
MIRT864133	hsa-miR-4699-3p	CLIP-seq
MIRT864134	hsa-miR-4776-3p	CLIP-seq
MIRT864135	hsa-miR-495	CLIP-seq
MIRT864136	hsa-miR-548a-5p	CLIP-seq
MIRT864137	hsa-miR-548ab	CLIP-seq
MIRT864138	hsa-miR-548ak	CLIP-seq
MIRT864139	hsa-miR-548b-5p	CLIP-seq
MIRT864140	hsa-miR-548c-3p	CLIP-seq
MIRT864141	hsa-miR-548c-5p	CLIP-seq
MIRT864142	hsa-miR-548d-5p	CLIP-seq
MIRT864143	hsa-miR-548h	CLIP-seq
MIRT864144	hsa-miR-548i	CLIP-seq
MIRT864145	hsa-miR-548j	CLIP-seq
MIRT864146	hsa-miR-548n	CLIP-seq
MIRT864147	hsa-miR-548t	CLIP-seq
MIRT864148	hsa-miR-548w	CLIP-seq
MIRT864149	hsa-miR-548y	CLIP-seq
MIRT864150	hsa-miR-559	CLIP-seq
MIRT864151	hsa-miR-802	CLIP-seq
MIRT864152	hsa-miR-888	CLIP-seq
MIRT864153	hsa-miR-1245	CLIP-seq
MIRT864154	hsa-miR-190	CLIP-seq
MIRT864155	hsa-miR-190b	CLIP-seq
MIRT864156	hsa-miR-23a	CLIP-seq
MIRT864157	hsa-miR-23b	CLIP-seq
MIRT864158	hsa-miR-23c	CLIP-seq
MIRT864159	hsa-miR-3115	CLIP-seq
MIRT864160	hsa-miR-3180-5p	CLIP-seq
MIRT864161	hsa-miR-320a	CLIP-seq
MIRT864162	hsa-miR-320b	CLIP-seq
MIRT864163	hsa-miR-320c	CLIP-seq
MIRT864164	hsa-miR-320d	CLIP-seq
MIRT864165	hsa-miR-3606	CLIP-seq
MIRT864166	hsa-miR-3690	CLIP-seq
MIRT864167	hsa-miR-3977	CLIP-seq
MIRT864168	hsa-miR-4254	CLIP-seq
MIRT864169	hsa-miR-4427	CLIP-seq
MIRT864170	hsa-miR-4429	CLIP-seq
MIRT864171	hsa-miR-4434	CLIP-seq
MIRT864172	hsa-miR-4516	CLIP-seq
MIRT864173	hsa-miR-4531	CLIP-seq
MIRT864174	hsa-miR-4640-5p	CLIP-seq
MIRT864175	hsa-miR-4668-3p	CLIP-seq
MIRT864176	hsa-miR-4680-3p	CLIP-seq
MIRT864177	hsa-miR-4726-5p	CLIP-seq
MIRT864178	hsa-miR-4755-3p	CLIP-seq
MIRT864179	hsa-miR-4762-3p	CLIP-seq
MIRT864180	hsa-miR-4765	CLIP-seq
MIRT864181	hsa-miR-520a-5p	CLIP-seq
MIRT864182	hsa-miR-525-5p	CLIP-seq
MIRT864183	hsa-miR-660	CLIP-seq
MIRT864184	hsa-miR-921	CLIP-seq
MIRT1956163	hsa-miR-1208	CLIP-seq
MIRT864134	hsa-miR-4776-3p	CLIP-seq
MIRT864166	hsa-miR-3690	CLIP-seq
MIRT864168	hsa-miR-4254	CLIP-seq
MIRT864175	hsa-miR-4668-3p	CLIP-seq
MIRT1956163	hsa-miR-1208	CLIP-seq
MIRT864129	hsa-miR-1236	CLIP-seq
MIRT864153	hsa-miR-1245	CLIP-seq
MIRT2497004	hsa-miR-1261	CLIP-seq
MIRT2497005	hsa-miR-1294	CLIP-seq
MIRT2497006	hsa-miR-1976	CLIP-seq
MIRT2497007	hsa-miR-2116	CLIP-seq
MIRT864156	hsa-miR-23a	CLIP-seq
MIRT864157	hsa-miR-23b	CLIP-seq
MIRT864158	hsa-miR-23c	CLIP-seq
MIRT864159	hsa-miR-3115	CLIP-seq
MIRT2497008	hsa-miR-3119	CLIP-seq
MIRT2497009	hsa-miR-3120-5p	CLIP-seq
MIRT2497010	hsa-miR-3189-3p	CLIP-seq
MIRT864165	hsa-miR-3606	CLIP-seq
MIRT2497011	hsa-miR-3646	CLIP-seq
MIRT2497012	hsa-miR-3655	CLIP-seq
MIRT2497013	hsa-miR-375	CLIP-seq
MIRT2497014	hsa-miR-4264	CLIP-seq
MIRT2497015	hsa-miR-4273	CLIP-seq
MIRT2497016	hsa-miR-4279	CLIP-seq
MIRT864174	hsa-miR-4640-5p	CLIP-seq
MIRT2497017	hsa-miR-4659a-3p	CLIP-seq
MIRT2497018	hsa-miR-4659b-3p	CLIP-seq
MIRT2497019	hsa-miR-4677-5p	CLIP-seq
MIRT2497020	hsa-miR-4678	CLIP-seq
MIRT2497021	hsa-miR-4697-3p	CLIP-seq
MIRT2497022	hsa-miR-4704-3p	CLIP-seq
MIRT2497023	hsa-miR-4710	CLIP-seq
MIRT2497024	hsa-miR-4722-3p	CLIP-seq
MIRT864177	hsa-miR-4726-5p	CLIP-seq
MIRT2497025	hsa-miR-4753-3p	CLIP-seq
MIRT864178	hsa-miR-4755-3p	CLIP-seq
MIRT2497026	hsa-miR-4780	CLIP-seq
MIRT2497027	hsa-miR-4786-5p	CLIP-seq
MIRT2497028	hsa-miR-4790-3p	CLIP-seq
MIRT2497029	hsa-miR-4792	CLIP-seq
MIRT2497030	hsa-miR-4797-3p	CLIP-seq
MIRT2497031	hsa-miR-483-3p	CLIP-seq
MIRT864135	hsa-miR-495	CLIP-seq
MIRT2497032	hsa-miR-549	CLIP-seq
MIRT2497033	hsa-miR-578	CLIP-seq
MIRT2497034	hsa-miR-623	CLIP-seq
MIRT2497035	hsa-miR-630	CLIP-seq
MIRT2497036	hsa-miR-653	CLIP-seq
MIRT2497037	hsa-miR-769-5p	CLIP-seq
MIRT864184	hsa-miR-921	CLIP-seq
MIRT2497038	hsa-miR-942	CLIP-seq
MIRT1956163	hsa-miR-1208	CLIP-seq
MIRT864129	hsa-miR-1236	CLIP-seq
MIRT864153	hsa-miR-1245	CLIP-seq
MIRT2497004	hsa-miR-1261	CLIP-seq
MIRT2497005	hsa-miR-1294	CLIP-seq
MIRT2497006	hsa-miR-1976	CLIP-seq
MIRT2497007	hsa-miR-2116	CLIP-seq
MIRT864156	hsa-miR-23a	CLIP-seq
MIRT864157	hsa-miR-23b	CLIP-seq
MIRT864158	hsa-miR-23c	CLIP-seq
MIRT864159	hsa-miR-3115	CLIP-seq
MIRT2497009	hsa-miR-3120-5p	CLIP-seq
MIRT2497010	hsa-miR-3189-3p	CLIP-seq
MIRT864165	hsa-miR-3606	CLIP-seq
MIRT2497011	hsa-miR-3646	CLIP-seq
MIRT2497014	hsa-miR-4264	CLIP-seq
MIRT2497015	hsa-miR-4273	CLIP-seq
MIRT2497016	hsa-miR-4279	CLIP-seq
MIRT864174	hsa-miR-4640-5p	CLIP-seq
MIRT2497017	hsa-miR-4659a-3p	CLIP-seq
MIRT2497018	hsa-miR-4659b-3p	CLIP-seq
MIRT2497019	hsa-miR-4677-5p	CLIP-seq
MIRT2497020	hsa-miR-4678	CLIP-seq
MIRT2497021	hsa-miR-4697-3p	CLIP-seq
MIRT2497022	hsa-miR-4704-3p	CLIP-seq
MIRT2497023	hsa-miR-4710	CLIP-seq
MIRT2497024	hsa-miR-4722-3p	CLIP-seq
MIRT864177	hsa-miR-4726-5p	CLIP-seq
MIRT2497025	hsa-miR-4753-3p	CLIP-seq
MIRT864178	hsa-miR-4755-3p	CLIP-seq
MIRT2497026	hsa-miR-4780	CLIP-seq
MIRT2497027	hsa-miR-4786-5p	CLIP-seq
MIRT2497028	hsa-miR-4790-3p	CLIP-seq
MIRT2497029	hsa-miR-4792	CLIP-seq
MIRT2497030	hsa-miR-4797-3p	CLIP-seq
MIRT2497031	hsa-miR-483-3p	CLIP-seq
MIRT2497032	hsa-miR-549	CLIP-seq
MIRT2497033	hsa-miR-578	CLIP-seq
MIRT2497034	hsa-miR-623	CLIP-seq
MIRT2497035	hsa-miR-630	CLIP-seq
MIRT2497036	hsa-miR-653	CLIP-seq
MIRT2497037	hsa-miR-769-5p	CLIP-seq
MIRT864184	hsa-miR-921	CLIP-seq
MIRT2497038	hsa-miR-942	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
E2F1	Activation	12766778
IRF1	Activation	10918594
RUNX3	Activation	15930301

Show/Hide all(71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	22464733
GO:0001650	Component	Fibrillar center	IDA
GO:0001778	Process	Plasma membrane repair	IDA	20530211
GO:0003723	Function	RNA binding	IDA	31586028
GO:0003723	Function	RNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004190	Function	Aspartic-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IBA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	11257230, 16123041, 16352606, 16374543, 16916640, 17646170, 18723680, 19581639, 19617626, 20566630, 21157428, 22184066, 22451931, 22464733, 23650375, 23897474, 24904167, 27032039, 27889207, 28863261, 31586028, 37327784
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IMP	22253444
GO:0004197	Function	Cysteine-type endopeptidase activity	ISS
GO:0005515	Function	Protein binding	IPI	11084335, 11257230, 11257231, 12888622, 21157428, 21555521, 25416956, 31467278, 31470122, 32296183, 32814053, 32911434, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	21157428
GO:0005634	Component	Nucleus	IDA	16374543, 19617626, 21555521, 22464733
GO:0005634	Component	Nucleus	IDA	17167422
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21555521
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8576161
GO:0005829	Component	Cytosol	IDA	16352606
GO:0005829	Component	Cytosol	IDA	17167422
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	15329343
GO:0006508	Process	Proteolysis	IDA	12888622
GO:0006508	Process	Proteolysis	IEA
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	IDA	17464193
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	8567622
GO:0007507	Process	Heart development	IEA
GO:0008233	Function	Peptidase activity	IDA	19740745
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	TAS	8567622
GO:0009411	Process	Response to UV	IEA
GO:0016485	Process	Protein processing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030163	Process	Protein catabolic process	IDA	16374543
GO:0030163	Process	Protein catabolic process	IDA	16374543, 22184066, 22464733
GO:0030163	Process	Protein catabolic process	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	22464733
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0044346	Process	Fibroblast apoptotic process	IEA
GO:0046513	Process	Ceramide biosynthetic process	IDA	17303575
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051604	Process	Protein maturation	IDA	21157428
GO:0051604	Process	Protein maturation	IEA
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	33186521
GO:0070227	Process	Lymphocyte apoptotic process	IEA
GO:0070227	Process	Lymphocyte apoptotic process	ISS
GO:0070269	Process	Pyroptotic inflammatory response	IDA	33883744
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	22464733
GO:0071887	Process	Leukocyte apoptotic process	IEA
GO:0072734	Process	Cellular response to staurosporine	IEA
GO:0072734	Process	Cellular response to staurosporine	IMP	22253444
GO:0097194	Process	Execution phase of apoptosis	IBA
GO:0097194	Process	Execution phase of apoptosis	IDA	16374543
GO:0097194	Process	Execution phase of apoptosis	IDA	16374543, 16916640, 22184066, 31586028
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:1905686	Process	Positive regulation of plasma membrane repair	IEA

MIM	HGNC	e!Ensembl
601761	1508	ENSG00000165806

Protein

UniProt ID

P55210

Protein name

Caspase-7 (CASP-7) (EC 3.4.22.60) (Apoptotic protease Mch-3) (CMH-1) (ICE-like apoptotic protease 3) (ICE-LAP3) [Cleaved into: Caspase-7 subunit p20; Caspase-7 subunit p11]

Protein function

Thiol protease involved in different programmed cell death processes, such as apoptosis, pyroptosis or granzyme-mediated programmed cell death, by proteolytically cleaving target proteins (PubMed:11257230, PubMed:11257231, PubMed:11701129, PubMe

PDB

1F1J , 1GQF , 1I4O , 1I51 , 1K86 , 1K88 , 1KMC , 1SHJ , 1SHL , 2QL5 , 2QL7 , 2QL9 , 2QLB , 2QLF , 2QLJ , 3EDR , 3H1P , 3IBC , 3IBF , 3R5K , 4FDL , 4FEA , 4HQ0 , 4HQR , 4JB8 , 4JJ8 , 4JR1 , 4JR2 , 4LSZ , 4ZVO , 4ZVP , 4ZVQ , 4ZVR , 4ZVS , 4ZVT , 4ZVU , 5IC6 , 5K20 , 5V6U , 5V6Z , 7WZS , 8DGZ , 8DJ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00656	Peptidase_C14	68 → 301		Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain. {ECO:0000269|PubMed:8576161}.

Sequence

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQY
NMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQ
DLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSW
FVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
FSQ

Sequence length

303

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Apoptosis Apoptosis - multiple species Cytosolic DNA-sensing pathway TNF signaling pathway Non-alcoholic fatty liver disease Alzheimer disease Pathways of neurodegeneration - multiple diseases Pathogenic Escherichia coli infection Salmonella infection Pertussis Legionellosis Pathways in cancer Lipid and atherosclerosis		Activation of caspases through apoptosome-mediated cleavage SMAC (DIABLO) binds to IAPs SMAC(DIABLO)-mediated dissociation of IAP:caspase complexes Apoptotic cleavage of cellular proteins SMAC, XIAP-regulated apoptotic response Caspase-mediated cleavage of cytoskeletal proteins

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast Cancer	Breast cancer	N/A	N/A	GWAS
Vitiligo	Vitiligo	N/A	N/A	GWAS

Show/Hide Text Mining Associations (79)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	21212151
Adenocarcinoma of Lung	Associate	20885442, 24972691
Alzheimer Disease	Associate	26621834, 27358062, 30503768
Amyotrophic Lateral Sclerosis	Stimulate	26159164
Autistic Disorder	Stimulate	23231720
Bloom Syndrome	Associate	32073752
Breast Neoplasms	Associate	19674193, 19724676, 21429729, 25220225, 26011589, 30259091, 30290054, 30602686, 34452574, 36615253, 37537243
Burkitt Lymphoma	Associate	22241218, 37569852
Calcinosis Cutis	Inhibit	22986525
Carcinoma Ductal Breast	Associate	21555521
Carcinoma Hepatocellular	Associate	21199322, 23830978, 35871161
Carcinoma Non Small Cell Lung	Associate	29642873
Carcinoma Pancreatic Ductal	Associate	33850476
Cerebral Infarction	Stimulate	31819117
Cerebral Infarction	Associate	31819117
Clinical Deterioration	Stimulate	25997515
Colorectal Neoplasms	Associate	20930850, 24407236, 24992592, 31601152, 36611995
COVID 19	Stimulate	36443881
Death	Associate	23805285
Diabetes Mellitus	Associate	19175688, 29302057
Diabetes Mellitus	Inhibit	29072691
Drug Related Side Effects and Adverse Reactions	Stimulate	15795449, 23152798
Drug Related Side Effects and Adverse Reactions	Associate	20138029, 21746806, 24989254, 31786278
Endometrial Neoplasms	Associate	19531679, 35725817, 37906351
Esophageal Neoplasms	Associate	24040159, 33742771, 38196829
Fever	Associate	17989736
Fever	Stimulate	23229357
Glioblastoma	Associate	18669646, 30670698
Glioma	Associate	18403493, 19001440, 26223576
Hearing Loss	Associate	33469117
Hearing Loss Noise Induced	Associate	33469117, 37815076
Hyperglycemia	Stimulate	23985558
Infections	Inhibit	15781584
Infections	Associate	30918127
Infections	Stimulate	33207682, 37227036
Inflammation	Associate	23231720, 27358062, 30298576, 35322136
Inflammation	Stimulate	25997515
Intervertebral Disc Degeneration	Associate	18302283
Leiomyosarcoma	Associate	22556343
Leukemia	Associate	20105315
Leukemia Myeloid Acute	Associate	21695163, 31831875
Leukemia Promyelocytic Acute	Associate	9920855
Lung Neoplasms	Associate	15006602, 20661084, 26307684, 38168007
Lung Neoplasms	Stimulate	20661084
Lymphoma Non Hodgkin	Associate	29391535
Medulloblastoma	Associate	19887560, 27537345
Melanoma	Associate	19383853, 23527236, 30989459, 31673075, 33833342
Mouth Neoplasms	Associate	23212344, 35328402
Mucopolysaccharidosis IV	Associate	37762422
Multiple Myeloma	Associate	34584036
Necrosis	Associate	20816779
Neoplasm Metastasis	Associate	17406026, 28639897
Neoplasms	Associate	19117056, 19241192, 19531679, 19617626, 19671764, 23807165, 23807226, 24040159, 24422969, 24622841, 24838641, 25784056, 27895316, 28281967, 33339164, 36575196, 36838715, 37119817 View all (3 more)
Neoplasms	Inhibit	22986525, 34638912
Nerve Degeneration	Associate	27358062
Neuroblastoma	Associate	14670183
Neurodegenerative Diseases	Associate	19617626
Obesity	Associate	23193206
Osteoarthritis	Associate	23603903
Osteosarcoma	Associate	20459702
Pancreatic Neoplasms	Associate	17406026, 21909380, 26247574, 26675757, 27936114
Philadelphia Chromosome	Associate	29542026
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	15142883
Precursor Cell Lymphoblastic Leukemia Lymphoma	Stimulate	26506264
Prostatic Neoplasms	Associate	15548330, 22564737, 22986525
Prostatitis	Associate	16519808
Prostatitis	Inhibit	22986525
Pulmonary Disease Chronic Obstructive	Associate	30298576
Sepsis	Associate	36443881
Sleep Deprivation	Associate	11943196
Small Cell Lung Carcinoma	Associate	26988918
Status Asthmaticus	Associate	15781584
Stomach Neoplasms	Associate	24040159, 24838641
Thyroid Carcinoma Anaplastic	Associate	26934320
Tinnitus	Associate	37815076
Triple Negative Breast Neoplasms	Associate	26909599, 35056723
Urinary Bladder Neoplasms	Associate	28433067
Uterine Cervical Neoplasms	Associate	25784056, 28639897
Vitreoretinopathy Proliferative	Associate	28777835

CASP7 (caspase 7)