Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	83998
Gene name Gene Name - the full gene name approved by the HGNC.	Regenerating family member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	REG4
Synonyms (NCBI Gene) Gene synonyms aliases	GISP, REG-IV, RELP
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p12

Show/Hide all(52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053779	hsa-miR-24-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24886316
MIRT053779	hsa-miR-24-3p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24886316
MIRT457335	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT457334	hsa-miR-4779	PAR-CLIP	23592263
MIRT457333	hsa-miR-9500	PAR-CLIP	23592263
MIRT457331	hsa-miR-3185	PAR-CLIP	23592263
MIRT457332	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT457330	hsa-miR-765	PAR-CLIP	23592263
MIRT457329	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT457328	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT457327	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457326	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457335	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT457334	hsa-miR-4779	PAR-CLIP	23592263
MIRT457333	hsa-miR-9500	PAR-CLIP	23592263
MIRT457331	hsa-miR-3185	PAR-CLIP	23592263
MIRT457332	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT457330	hsa-miR-765	PAR-CLIP	23592263
MIRT457329	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT457328	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT457327	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457326	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT1299986	hsa-miR-1286	CLIP-seq
MIRT1299987	hsa-miR-3148	CLIP-seq
MIRT1299988	hsa-miR-3926	CLIP-seq
MIRT1299989	hsa-miR-3944-5p	CLIP-seq
MIRT1299990	hsa-miR-4433	CLIP-seq
MIRT1299991	hsa-miR-4524	CLIP-seq
MIRT1299992	hsa-miR-4653-3p	CLIP-seq
MIRT1299993	hsa-miR-4675	CLIP-seq
MIRT1299994	hsa-miR-4722-5p	CLIP-seq
MIRT1299995	hsa-miR-4741	CLIP-seq
MIRT1299996	hsa-miR-548s	CLIP-seq
MIRT2089200	hsa-miR-578	CLIP-seq
MIRT2313999	hsa-miR-3622b-5p	CLIP-seq
MIRT2314000	hsa-miR-4536	CLIP-seq
MIRT2610558	hsa-miR-181a	CLIP-seq
MIRT2610559	hsa-miR-181b	CLIP-seq
MIRT2610560	hsa-miR-181c	CLIP-seq
MIRT2610561	hsa-miR-181d	CLIP-seq
MIRT2610562	hsa-miR-197	CLIP-seq
MIRT2610563	hsa-miR-3692	CLIP-seq
MIRT2610564	hsa-miR-4262	CLIP-seq
MIRT2610565	hsa-miR-885-5p	CLIP-seq
MIRT2610558	hsa-miR-181a	CLIP-seq
MIRT2610559	hsa-miR-181b	CLIP-seq
MIRT2610560	hsa-miR-181c	CLIP-seq
MIRT2610561	hsa-miR-181d	CLIP-seq
MIRT2610562	hsa-miR-197	CLIP-seq
MIRT2610563	hsa-miR-3692	CLIP-seq
MIRT2610564	hsa-miR-4262	CLIP-seq
MIRT2610565	hsa-miR-885-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CDX2	Unknown	23133598
TSG101	Repression	18643869

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IDA	20692269
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	12819006
GO:0008201	Function	Heparin binding	IDA	20692269
GO:0009617	Process	Response to bacterium	IEA
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:2001065	Function	Mannan binding	IBA	21873635
GO:2001065	Function	Mannan binding	IDA	20692269

MIM	HGNC	e!Ensembl
609846	22977	ENSG00000134193

Protein

UniProt ID

Q9BYZ8

Protein name

Regenerating islet-derived protein 4 (REG-4) (Gastrointestinal secretory protein) (REG-like protein) (Regenerating islet-derived protein IV) (Reg IV)

Protein function

Calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium. {ECO

PDB

2KV3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	47 → 156	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colore

Sequence

MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSG
KSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Sequence length

158

Interactions

View interactions

	KEGG
	Gastric cancer

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Gastric cancer	Hereditary Diffuse Gastric Cancer	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)	17237819

Show/Hide Text Mining Associations (42)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	19136934, 20349522, 22018336
Adenocarcinoma Mucinous	Associate	19136934, 21339177, 25295732, 26077911, 34577861, 36690709
Adenoma	Associate	20349522
Brain Neoplasms	Associate	22018336
Breast Neoplasms	Stimulate	37218920
Carcinogenesis	Associate	19136934, 37218920
Carcinoma Ovarian Epithelial	Associate	26077911
Carcinoma Pancreatic Ductal	Associate	27788482, 29542402, 35773268
Cholangiocarcinoma	Associate	27788482
Cholecystitis	Associate	22018336
Colitis Ulcerative	Associate	17260007, 35946046
Colorectal Neoplasms	Associate	17260007, 19136934, 25295732, 26077911, 34577861
Colorectal Neoplasms	Stimulate	24151146, 34753802
Crohn Disease	Associate	35946046
Death	Inhibit	25295732
Diabetes Mellitus	Associate	29754148
Gallbladder Diseases	Associate	22018336
Gastrointestinal Neoplasms	Associate	24151146, 29542402
Gastrointestinal Neoplasms	Stimulate	28759561, 34753802
Glioma	Associate	22713481
Hypersensitivity Immediate	Associate	19136934
Inflammation	Associate	23519454, 37218920
Inflammatory Bowel Diseases	Associate	18754868, 23519454, 25295732
Inflammatory Bowel Diseases	Stimulate	29542402, 35946046
Intestinal Diseases	Associate	20398667
Liver Neoplasms	Stimulate	35929918
Lung Neoplasms	Associate	24065141
Metaplasia	Associate	20398667
Neoplasm Metastasis	Associate	31905926
Neoplasms	Associate	17260007, 18754868, 19136934, 20349522, 22713481, 23133598, 26077911, 29587675, 29754148, 34753802, 35929918, 37218920
Neuroendocrine Tumors	Associate	20349522
Ovarian Diseases	Associate	26077911
Ovarian Neoplasms	Associate	26077911, 26981633, 31659102, 35929918
Pancreatic Intraductal Neoplasms	Associate	19136934
Pancreatic Neoplasms	Associate	21494603, 22957785, 29157747, 34499727
Pancreatic Neoplasms	Stimulate	34753802
Peritonitis	Stimulate	27036049
Polyps	Associate	24533081
Prostatic Neoplasms	Associate	18754868
Stomach Neoplasms	Associate	17237819, 19329938, 20398667, 22048633, 23133598, 25517873, 27036049, 29587675, 33639844
Stomach Neoplasms	Stimulate	28759561
Uterine Cervical Neoplasms	Associate	37218920

REG4 (regenerating family member 4)