Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	83998
Gene name	Regenerating family member 4
Gene symbol	REG4
Synonyms (NCBI Gene)	GISPREG-IVRELP
Chromosome	1
Chromosome location	1p12

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053779	hsa-miR-24-3p	FlowImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24886316
MIRT053779	hsa-miR-24-3p	FlowImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24886316
MIRT457335	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT457334	hsa-miR-4779	PAR-CLIP	23592263
MIRT457333	hsa-miR-9500	PAR-CLIP	23592263
MIRT457331	hsa-miR-3185	PAR-CLIP	23592263
MIRT457332	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT457330	hsa-miR-765	PAR-CLIP	23592263
MIRT457329	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT457328	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT457327	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457326	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT457335	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT457334	hsa-miR-4779	PAR-CLIP	23592263
MIRT457333	hsa-miR-9500	PAR-CLIP	23592263
MIRT457331	hsa-miR-3185	PAR-CLIP	23592263
MIRT457332	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT457330	hsa-miR-765	PAR-CLIP	23592263
MIRT457329	hsa-miR-1249-5p	PAR-CLIP	23592263
MIRT457328	hsa-miR-6797-5p	PAR-CLIP	23592263
MIRT457327	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT457326	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT1299986	hsa-miR-1286	CLIP-seq
MIRT1299987	hsa-miR-3148	CLIP-seq
MIRT1299988	hsa-miR-3926	CLIP-seq
MIRT1299989	hsa-miR-3944-5p	CLIP-seq
MIRT1299990	hsa-miR-4433	CLIP-seq
MIRT1299991	hsa-miR-4524	CLIP-seq
MIRT1299992	hsa-miR-4653-3p	CLIP-seq
MIRT1299993	hsa-miR-4675	CLIP-seq
MIRT1299994	hsa-miR-4722-5p	CLIP-seq
MIRT1299995	hsa-miR-4741	CLIP-seq
MIRT1299996	hsa-miR-548s	CLIP-seq
MIRT2089200	hsa-miR-578	CLIP-seq
MIRT2313999	hsa-miR-3622b-5p	CLIP-seq
MIRT2314000	hsa-miR-4536	CLIP-seq
MIRT2610558	hsa-miR-181a	CLIP-seq
MIRT2610559	hsa-miR-181b	CLIP-seq
MIRT2610560	hsa-miR-181c	CLIP-seq
MIRT2610561	hsa-miR-181d	CLIP-seq
MIRT2610562	hsa-miR-197	CLIP-seq
MIRT2610563	hsa-miR-3692	CLIP-seq
MIRT2610564	hsa-miR-4262	CLIP-seq
MIRT2610565	hsa-miR-885-5p	CLIP-seq
MIRT2610558	hsa-miR-181a	CLIP-seq
MIRT2610559	hsa-miR-181b	CLIP-seq
MIRT2610560	hsa-miR-181c	CLIP-seq
MIRT2610561	hsa-miR-181d	CLIP-seq
MIRT2610562	hsa-miR-197	CLIP-seq
MIRT2610563	hsa-miR-3692	CLIP-seq
MIRT2610564	hsa-miR-4262	CLIP-seq
MIRT2610565	hsa-miR-885-5p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CDX2	Unknown	23133598
TSG101	Repression	18643869

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IDA	20692269
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	12819006
GO:0008201	Function	Heparin binding	IDA	20692269
GO:0009617	Process	Response to bacterium	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:2001065	Function	Mannan binding	IBA
GO:2001065	Function	Mannan binding	IDA	20692269

MIM	HGNC	e!Ensembl
609846	22977	ENSG00000134193

Q9BYZ8

Protein name

Regenerating islet-derived protein 4 (REG-4) (Gastrointestinal secretory protein) (REG-like protein) (Regenerating islet-derived protein IV) (Reg IV)

Protein function

Calcium-independent lectin displaying mannose-binding specificity and able to maintain carbohydrate recognition activity in an acidic environment. May be involved in inflammatory and metaplastic responses of the gastrointestinal epithelium. {ECO

PDB

2KV3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	47 → 156	Lectin C-type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the gastrointestinal tract including the duodenum, jejunum, ileum, ileocecum, appendix, descending colon, pancreas and small intestine. Weakly expressed in normal colon and stomach. Strongly expressed in most colore

Sequence

MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSG
KSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Sequence length

158

Interactions

View interactions

	KEGG
	Gastric cancer

REG4 (regenerating family member 4)