HDAC10 (histone deacetylase 10)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83933
Gene name Gene Name - the full gene name approved by the HGNC.
Histone deacetylase 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HDAC10
Synonyms (NCBI Gene) Gene synonyms aliases
HD10
Chromosome Chromosome number
22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the histone deacetylase family, members of which deacetylate lysine residues on the N-terminal part of the core histones. Histone deacetylation modulates chromatin structure, and plays an important role in trans
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
miRTarBase ID miRNA Experiments Reference
MIRT050881 hsa-miR-17-5p CLASH 23622248
MIRT732542 hsa-miR-223-3p Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting 33481338
MIRT732778 hsa-miR-1908-3p Luciferase reporter assay, qRT-PCR 33493381
MIRT2008891 hsa-miR-744 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(31)
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex IDA 11861901
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11726666
GO:0004407 Function Histone deacetylase activity IDA 11861901
GO:0004407 Function Histone deacetylase activity TAS
GO:0005515 Function Protein binding IPI 17172643, 23801752, 26221039, 31391242, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
608544 18128 ENSG00000100429
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q969S8
Protein name Polyamine deacetylase HDAC10 (EC 3.5.1.48) (EC 3.5.1.62) (Histone deacetylase 10) (HD10)
Protein function Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00850 Hist_deacetyl 24 → 321 Histone deacetylase domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high levels in liver and kidney. {ECO:0000269|PubMed:11677242, ECO:0000269|PubMed:11739383, ECO:0000269|PubMed:11861901}.
Sequence 
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQ
DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
LQCHPHLVA
Sequence length 669
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis 		  Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
HDACs deacetylate histones
Notch-HLH transcription pathway
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Text Mining Associations (21)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 34308568, 39237939
Emphysema Associate 30214182
Ependymoma Associate 25909290
Epilepsy Familial Mesial Temporal Lobe Associate 33258018
Glioma Associate 37528157
Glomerulonephritis IGA Associate 30029622
Leukemia Lymphocytic Chronic B Cell Associate 23108383
Melanoma Inhibit 24850177
Multiple Myeloma Associate 25482492
Neoplasm Metastasis Associate 39237939