HDAC10 (histone deacetylase 10)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 83933
Gene name Histone deacetylase 10
Gene symbol HDAC10
Synonyms (NCBI Gene)
HD10
Chromosome 22
Chromosome location 22q13.33
Summary The protein encoded by this gene belongs to the histone deacetylase family, members of which deacetylate lysine residues on the N-terminal part of the core histones. Histone deacetylation modulates chromatin structure, and plays an important role in trans
miRNA miRNA information provided by mirtarbase database.
4
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (4)
miRTarBase ID miRNA Experiments Reference
MIRT050881 hsa-miR-17-5p CLASH 23622248
MIRT732542 hsa-miR-223-3p Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting 33481338
MIRT732778 hsa-miR-1908-3p Luciferase reporter assayqRT-PCR 33493381
MIRT2008891 hsa-miR-744 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
41
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (41)
GO ID Ontology Definition Evidence Reference
GO:0000118 Component Histone deacetylase complex IDA 11861901
GO:0000118 Component Histone deacetylase complex IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 11726666
GO:0004407 Function Histone deacetylase activity IDA 11739383, 11861901
GO:0004407 Function Histone deacetylase activity TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
608544 18128 ENSG00000100429
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q969S8
Protein name Polyamine deacetylase HDAC10 (EC 3.5.1.48) (EC 3.5.1.62) (Histone deacetylase 10) (HD10)
Protein function Polyamine deacetylase (PDAC), which acts preferentially on N(8)-acetylspermidine, and also on acetylcadaverine and acetylputrescine (PubMed:28516954). Exhibits attenuated catalytic activity toward N(1),N(8)-diacetylspermidine and very low activi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00850 Hist_deacetyl 24 → 321 Histone deacetylase domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with high levels in liver and kidney. {ECO:0000269|PubMed:11677242, ECO:0000269|PubMed:11739383, ECO:0000269|PubMed:11861901}.
Sequence 
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQ
DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
LQCHPHLVA
Sequence length 669
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Neutrophil extracellular trap formation
Alcoholism
Viral carcinogenesis 		  Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
HDACs deacetylate histones
Notch-HLH transcription pathway
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Colon adenocarcinoma Uncertain significance rs145098215 RCV005929119
Thyroid cancer, nonmedullary, 1 Uncertain significance rs145098215 RCV005929120
Show/Hide Text Mining Associations (21)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 34308568, 39237939
Emphysema Associate 30214182
Ependymoma Associate 25909290
Epilepsy Familial Mesial Temporal Lobe Associate 33258018
Glioma Associate 37528157
Glomerulonephritis IGA Associate 30029622
Leukemia Lymphocytic Chronic B Cell Associate 23108383
Melanoma Inhibit 24850177
Multiple Myeloma Associate 25482492
Neoplasm Metastasis Associate 39237939