Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83892
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium channel tetramerization domain containing 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCTD10
Synonyms (NCBI Gene) Gene synonyms aliases
BTBD28, MSTP028, ULRO61, hBACURD3
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.11
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene binds proliferating cell nuclear antigen (PCNA) and may be involved in DNA synthesis and cell proliferation. In addition, the encoded protein may be a tumor suppressor. Several protein-coding and non-protein coding transcr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019854 hsa-miR-375 Microarray 20215506
MIRT020169 hsa-miR-130b-3p Sequencing 20371350
MIRT031145 hsa-miR-19b-3p Sequencing 20371350
MIRT041231 hsa-miR-193b-3p CLASH 23622248
MIRT536534 hsa-miR-548c-3p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IBA
GO:0004842 Function Ubiquitin-protein transferase activity ISS
GO:0005112 Function Notch binding IPI 25401743
GO:0005515 Function Protein binding IPI 19615732, 21145461, 32296183, 33961781, 34591642
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613421 23236 ENSG00000110906
Protein
UniProt ID Q9H3F6
Protein name BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 (hBACURD3) (BTB/POZ domain-containing protein KCTD10) (Potassium channel tetramerization domain-containing protein 10)
Protein function Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex. The BCR(BACURD3) E3 ubiquitin ligase complex mediates the ubiquitination of target proteins, leading to their degradation by the proteasome (By similarity).
PDB 5FTA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02214 BTB_2 34 124 BTB/POZ domain Domain
Sequence
MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAM
FSGRMEVLTDSEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGL
VEEC
QAALQNKDTYEPFCKVPVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDD
NMLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKIAEVCCTSIVYATEKKQT
KVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGGAAGRSHHLDEDEERERIERVRRI
HIKRPDDRAHLHQ
Sequence length 313
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Multiple Congenital Anomalies multiple congenital anomalies/dysmorphic syndrome N/A N/A GenCC
Neuroticism Neuroticism N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 30515933
Carcinogenesis Associate 29049217
Carcinoma Hepatocellular Associate 31280863
Coronary Disease Associate 27716295
Coronary Disease Inhibit 27716295
Dyslipidemias Associate 27716295
Gastrointestinal Stromal Tumors Associate 23977394
Glycogen Storage Disease Type II Associate 25205864
Macular Degeneration Associate 30696427, 31583032
Neoplasms Inhibit 23977394