BCO2 (beta-carotene oxygenase 2)

Gene

• Entrez ID: 83875
• Gene name: Beta-carotene oxygenase 2
• Gene symbol: BCO2
• Synonyms (NCBI Gene): B-DIOX-II, BCDO2
• Chromosome: 11
• Chromosome location: 11q23.1
• Summary: This gene encodes an enzyme which oxidizes carotenoids such as beta-carotene during the biosynthesis of vitamin A. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT820204	hsa-miR-1236	CLIP-seq
MIRT820205	hsa-miR-376c	CLIP-seq
MIRT820206	hsa-miR-3944-5p	CLIP-seq
MIRT820207	hsa-miR-4313	CLIP-seq
MIRT820208	hsa-miR-4314	CLIP-seq
MIRT820209	hsa-miR-4666-5p	CLIP-seq
MIRT820210	hsa-miR-4667-5p	CLIP-seq
MIRT820211	hsa-miR-4691-5p	CLIP-seq
MIRT820212	hsa-miR-4700-5p	CLIP-seq
MIRT820213	hsa-miR-489	CLIP-seq
MIRT820214	hsa-miR-502-5p	CLIP-seq
MIRT820215	hsa-miR-637	CLIP-seq
MIRT1942391	hsa-miR-1206	CLIP-seq
MIRT1942392	hsa-miR-203	CLIP-seq
MIRT1942393	hsa-miR-579	CLIP-seq
MIRT1942394	hsa-miR-600	CLIP-seq
MIRT2181081	hsa-miR-136	CLIP-seq
MIRT2181082	hsa-miR-15a	CLIP-seq
MIRT2181083	hsa-miR-15b	CLIP-seq
MIRT2181084	hsa-miR-16	CLIP-seq
MIRT2181085	hsa-miR-192	CLIP-seq
MIRT2181086	hsa-miR-195	CLIP-seq
MIRT2181087	hsa-miR-215	CLIP-seq
MIRT2181088	hsa-miR-217	CLIP-seq
MIRT2181089	hsa-miR-3199	CLIP-seq
MIRT2181090	hsa-miR-338-3p	CLIP-seq
MIRT2181091	hsa-miR-3908	CLIP-seq
MIRT2181092	hsa-miR-424	CLIP-seq
MIRT2181093	hsa-miR-4418	CLIP-seq
MIRT2181094	hsa-miR-4530	CLIP-seq
MIRT2181095	hsa-miR-4540	CLIP-seq
MIRT820213	hsa-miR-489	CLIP-seq
MIRT2181096	hsa-miR-497	CLIP-seq
MIRT2181097	hsa-miR-509-3-5p	CLIP-seq
MIRT2181098	hsa-miR-509-5p	CLIP-seq
MIRT2181099	hsa-miR-554	CLIP-seq
MIRT2181100	hsa-miR-606	CLIP-seq
MIRT2181101	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003834	Function	Beta-carotene 15,15'-dioxygenase activity	IBA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS	21106934
GO:0005739	Component	Mitochondrion	TAS	21106934
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0010436	Function	Carotenoid dioxygenase activity	IBA
GO:0010437	Function	9,10 (9', 10')-carotenoid-cleaving dioxygenase activity	ISS
GO:0016116	Process	Carotenoid metabolic process	IEA
GO:0016116	Process	Carotenoid metabolic process	ISS	21106934
GO:0016119	Process	Carotene metabolic process	IDA	11278918
GO:0016119	Process	Carotene metabolic process	IEA
GO:0016121	Process	Carotene catabolic process	IBA
GO:0016121	Process	Carotene catabolic process	IDA	21302131
GO:0016121	Process	Carotene catabolic process	IEA
GO:0016122	Process	Xanthophyll metabolic process	IEA
GO:0016124	Process	Xanthophyll catabolic process	IEA
GO:0016124	Process	Xanthophyll catabolic process	ISS
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	11278918, 21302131
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IEA
GO:0042573	Process	Retinoic acid metabolic process	NAS	11278918
GO:0042574	Process	Retinal metabolic process	IBA
GO:0042574	Process	Retinal metabolic process	IEA
GO:0042574	Process	Retinal metabolic process	NAS	11278918
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	ISS	21106934
GO:0062172	Process	Lutein catabolic process	ISS
GO:0102076	Function	Beta,beta-carotene-9',10'-cleaving oxygenase activity	IEA
GO:0102076	Function	Beta,beta-carotene-9',10'-cleaving oxygenase activity	ISS
GO:1901176	Process	Lycopene catabolic process	ISS
GO:1901826	Process	Zeaxanthin catabolic process	ISS
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	ISS	21106934

Other IDs

• MIM: 611740
• HGNC: 18503
• e!Ensembl: ENSG00000197580

Protein

• UniProt ID: Q9BYV7
• Protein name: Carotenoid-cleaving dioxygenase, mitochondrial (EC 1.13.11.-) (EC 1.13.11.71) (B-diox-II) (Beta,beta-carotene 9',10'-oxygenase) (Beta-carotene dioxygenase 2)
• Protein function: Broad specificity mitochondrial dioxygenase that mediates the asymmetric oxidative cleavage of carotenoids. Cleaves carotenes (pure hydrocarbon carotenoids) such as all-trans-beta-carotene and lycopene as well as xanthophylls (oxygenated caroten
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03055	RPE65	58 → 578	Retinal pigment epithelial membrane protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in retinal pigment epithelium. Also expressed in stomach, small intestine, liver, testis, kidney, adrenal gland, pancreas, heart, skeletal muscle and prostate (at protein level). {ECO:0000269|PubMed:15983114}.
• Sequence:

  MFFRVFLHFIRSHSATAVDFLPVMVHRLPVFKRYMGNTPQKKAVFGQCRGLPCVAPLLTT
  VEEAPRGISARVWGHFPKWLNGSLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMAKGTVT
  YRSKFLQSDTYKANSAKNRIVISEFGTLALPDPCKNVFERFMSRFELPGKAAAMTDNTNV
  NYVRYKGDYYLCTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDLDGTAYNMGN
  SFGPYGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQ
  PLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQIN
  AFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLN
  APEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHF
  FYGCGFRHLVGDSLIKVDVVNKTLKVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITP
  NQNESNFILVLDAKNFEELGRAEVPVQMPYGFHGTFIPI

• Sequence length: 579

Pathways

Reactome:

Retinoid metabolism and transport

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
HIGH DENSITY LIPOPROTEIN CHOLESTEROL LEVEL QUANTITATIVE TRAIT LOCUS 6	Uncertain significance	rs780599024	RCV003990860
Lung cancer	Uncertain significance	rs202014484	RCV005927184

Associations from Text Mining
Disease Name	Relationship Type	References
Cerebral Infarction	Associate	31250580
Diabetes Mellitus Type 2	Associate	18853133
Macular Degeneration	Associate	24346170
Neoplasms	Associate	27406826
Prostatic Neoplasms	Associate	27406826