KCNK16 (potassium two pore domain channel subfamily K member 16)

Gene

• Entrez ID: 83795
• Gene name: Potassium two pore domain channel subfamily K member 16
• Gene symbol: KCNK16
• Synonyms (NCBI Gene): K2p16.1, TALK-1, TALK1
• Chromosome: 6
• Chromosome location: 6p21.2
• Summary: The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is expres

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT662050	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT662049	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT662048	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT662047	hsa-miR-7977	HITS-CLIP	23824327
MIRT662046	hsa-miR-578	HITS-CLIP	23824327
MIRT662050	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT662049	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT662048	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT662047	hsa-miR-7977	HITS-CLIP	23824327
MIRT662046	hsa-miR-578	HITS-CLIP	23824327
MIRT1081826	hsa-miR-216a	CLIP-seq
MIRT1081827	hsa-miR-513c	CLIP-seq
MIRT1081828	hsa-miR-514b-5p	CLIP-seq
MIRT1081829	hsa-miR-3689a-3p	CLIP-seq
MIRT1081830	hsa-miR-3689c	CLIP-seq
MIRT1081831	hsa-miR-4728-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005267	Function	Potassium channel activity	IDA	11263999, 12724142, 28928238
GO:0005267	Function	Potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 36063992
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	28928238
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IDA	11263999, 12724142
GO:0006813	Process	Potassium ion transport	IEA
GO:0015271	Function	Outward rectifier potassium channel activity	IBA
GO:0015271	Function	Outward rectifier potassium channel activity	IDA	26919430, 34032641, 36063992
GO:0016020	Component	Membrane	IEA
GO:0022841	Function	Potassium ion leak channel activity	IBA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IMP	28928238
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042802	Function	Identical protein binding	IDA	36063992
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	36063992
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IMP	34032641
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0086011	Process	Membrane repolarization during action potential	ISS
GO:0098900	Process	Regulation of action potential	IMP	34032641

Other IDs

• MIM: 607369
• HGNC: 14464
• e!Ensembl: ENSG00000095981

Protein

• UniProt ID: Q96T55
• Protein name: Potassium channel subfamily K member 16 (2P domain potassium channel Talk-1) (TWIK-related alkaline pH-activated K(+) channel 1) (TALK-1)
• Protein function: K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07885	Ion_trans_2	64 → 149	Ion channel	Family
  PF07885	Ion_trans_2	169 → 254	Ion channel	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in pancreas, in both endocrine (alpha, beta, gamma, delta, and epsilon) and exocrine (acinar and ductal) cells. Expressed in pacreatic beta-cells (at protein level). Expressed in pacreatic delta-cells (at protein level
• Sequence:

  MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC
  LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
  GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT
  LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
  LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF
  PISKKGLGS

• Sequence length: 309

Pathways

Reactome:

TWIK-related alkaline pH activated K+ channel (TALK)
Phase 4 - resting membrane potential