KCNK16 (potassium two pore domain channel subfamily K member 16)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83795
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium two pore domain channel subfamily K member 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNK16
Synonyms (NCBI Gene) Gene synonyms aliases
K2p16.1, TALK-1, TALK1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is expres
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
miRTarBase ID miRNA Experiments Reference
MIRT662050 hsa-miR-1910-5p HITS-CLIP 23824327
MIRT662049 hsa-miR-6787-3p HITS-CLIP 23824327
MIRT662048 hsa-miR-432-5p HITS-CLIP 23824327
MIRT662047 hsa-miR-7977 HITS-CLIP 23824327
MIRT662046 hsa-miR-578 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0005244 Function Voltage-gated ion channel activity IEA
GO:0005267 Function Potassium channel activity IDA 11263999, 12724142
GO:0005515 Function Protein binding IPI 25416956
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607369 14464 ENSG00000095981
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q96T55
Protein name Potassium channel subfamily K member 16 (2P domain potassium channel Talk-1) (TWIK-related alkaline pH-activated K(+) channel 1) (TALK-1)
Protein function K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 64 → 149 Ion channel Family
PF07885 Ion_trans_2 169 → 254 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in pancreas, in both endocrine (alpha, beta, gamma, delta, and epsilon) and exocrine (acinar and ductal) cells. Expressed in pacreatic beta-cells (at protein level). Expressed in pacreatic delta-cells (at protein level
Sequence 
MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC
LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF
PISKKGLGS
Sequence length 309
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    TWIK-related alkaline pH activated K+ channel (TALK)
Phase 4 - resting membrane potential
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 22158537, 28869590
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Diabetes Mellitus Type 2 Associate 23372846, 24086726, 31145772
Neoplasms Associate 24116006