Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	83795
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium two pore domain channel subfamily K member 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNK16
Synonyms (NCBI Gene) Gene synonyms aliases	K2p16.1, TALK-1, TALK1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is expres

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments	Reference
MIRT662050	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT662049	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT662048	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT662047	hsa-miR-7977	HITS-CLIP	23824327
MIRT662046	hsa-miR-578	HITS-CLIP	23824327
MIRT662050	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT662049	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT662048	hsa-miR-432-5p	HITS-CLIP	23824327
MIRT662047	hsa-miR-7977	HITS-CLIP	23824327
MIRT662046	hsa-miR-578	HITS-CLIP	23824327
MIRT1081826	hsa-miR-216a	CLIP-seq
MIRT1081827	hsa-miR-513c	CLIP-seq
MIRT1081828	hsa-miR-514b-5p	CLIP-seq
MIRT1081829	hsa-miR-3689a-3p	CLIP-seq
MIRT1081830	hsa-miR-3689c	CLIP-seq
MIRT1081831	hsa-miR-4728-5p	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005267	Function	Potassium channel activity	IDA	11263999, 12724142, 28928238
GO:0005267	Function	Potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 36063992
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	28928238
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IDA	11263999, 12724142
GO:0006813	Process	Potassium ion transport	IEA
GO:0015271	Function	Outward rectifier potassium channel activity	IBA
GO:0015271	Function	Outward rectifier potassium channel activity	IDA	26919430, 34032641, 36063992
GO:0016020	Component	Membrane	IEA
GO:0022841	Function	Potassium ion leak channel activity	IBA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IMP	28928238
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042802	Function	Identical protein binding	IDA	36063992
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	36063992
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IEA
GO:0051279	Process	Regulation of release of sequestered calcium ion into cytosol	IMP	34032641
GO:0061178	Process	Regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0086011	Process	Membrane repolarization during action potential	ISS
GO:0098900	Process	Regulation of action potential	IMP	34032641

MIM	HGNC	e!Ensembl
607369	14464	ENSG00000095981

Protein

UniProt ID

Q96T55

Protein name

Potassium channel subfamily K member 16 (2P domain potassium channel Talk-1) (TWIK-related alkaline pH-activated K(+) channel 1) (TALK-1)

Protein function

K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07885	Ion_trans_2	64 → 149	Ion channel	Family
PF07885	Ion_trans_2	169 → 254	Ion channel	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in pancreas, in both endocrine (alpha, beta, gamma, delta, and epsilon) and exocrine (acinar and ductal) cells. Expressed in pacreatic beta-cells (at protein level). Expressed in pacreatic delta-cells (at protein level

Sequence

MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC
LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF
PISKKGLGS

Sequence length

309

Interactions

View interactions

	Reactome
			TWIK-related alkaline pH activated K+ channel (TALK) Phase 4 - resting membrane potential

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Diabetes Mellitus Type 2	Associate	23372846, 24086726, 31145772
Neoplasms	Associate	24116006

KCNK16 (potassium two pore domain channel subfamily K member 16)