TFAP2D (transcription factor AP-2 delta)

Gene

• Entrez ID: 83741
• Gene name: Transcription factor AP-2 delta
• Gene symbol: TFAP2D
• Synonyms (NCBI Gene): AP-2delta, TFAP2BL1
• Chromosome: 6
• Chromosome location: 6p12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1419951	hsa-miR-129-5p	CLIP-seq
MIRT1419952	hsa-miR-2355-3p	CLIP-seq
MIRT1419953	hsa-miR-4646-3p	CLIP-seq
MIRT1419954	hsa-miR-579	CLIP-seq
MIRT1419955	hsa-miR-676	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0061379	Process	Inferior colliculus development	IEA

Other IDs

• MIM: 610161
• HGNC: 15581
• e!Ensembl: ENSG00000008197

Protein

• UniProt ID: Q7Z6R9
• Protein name: Transcription factor AP-2-delta (AP2-delta) (Activating enhancer-binding protein 2-delta) (Transcription factor AP-2-beta-like 1)
• Protein function: Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a la
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03299	TF_AP-2	211 → 405	Transcription factor AP-2	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain, placenta, skeletal muscle, thymus, small intestine, and prostate, and expressed at lower levels in leukocyte, spleen, testis, ovary and colon. Barely detectable in heart, kidney, liver, lung or pancreas. {ECO
• Sequence:

  MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYSTTGTEFASPYF
  STNHQYTPLHHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQIHHGEPTDFINLHNAR
  ALKSSCLDEQRRELGCLDAYRRHDLSLMSHGSQYGMHPDQRLLPGPSLGLAAAGADDLQG
  SVEAQCGLVLNGQGGVIRRGGTCVVNPTDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSP
  PECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHL
  ARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQDLLSQDRSPLG
  SSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGA
  ADSGQGHANSEKAPLRKTSEAAVKEGKTEKTD

• Sequence length: 452

Pathways

Reactome:

Negative regulation of activity of TFAP2 (AP-2) family transcription factors
Activation of the TFAP2 (AP-2) family of transcription factors