Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83729
Gene name Gene Name - the full gene name approved by the HGNC.
Inhibin subunit beta E
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
INHBE
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate an inhibin beta subunit. Inhibins have been implicated in regulating numerous cellular
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016770 hsa-miR-335-5p Microarray 18185580
MIRT027405 hsa-miR-98-5p Microarray 19088304
MIRT739666 hsa-miR-1470 CLIP-seq
MIRT1066651 hsa-miR-1827 CLIP-seq
MIRT1066652 hsa-miR-3148 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity ISS
GO:0005179 Function Hormone activity IEA
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612031 24029 ENSG00000139269
Protein
UniProt ID P58166
Protein name Inhibin beta E chain (Activin beta-E chain)
Protein function Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonad
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00019 TGF_beta 246 349 Transforming growth factor beta like domain Domain
Sequence
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSR
PRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHH
LYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRG
EKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTC
EPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGC
S
Sequence length 350
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells
  Glycoprotein hormones
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 17074342
Adenocarcinoma Of Esophagus Associate 36064338
Angina Unstable Associate 15261933
Anodontia Associate 17258738
Asthma Associate 19733294
Atherosclerosis Associate 10559140, 20954112
Barrett Esophagus Associate 26447543
Brain Neoplasms Associate 7670558
Breast Neoplasms Associate 11278744, 30343527, 37870468
Cachexia Associate 32970737