Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	837
Gene name	Caspase 4
Gene symbol	CASP4
Synonyms (NCBI Gene)	ICE(rel)IIICEREL-IIICH-2Mih1Mih1/TXTX
Chromosome	11
Chromosome location	11q22.3
Summary	This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prod

Show/Hide all (1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030229	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	25119034, 37993712
GO:0002376	Process	Immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	16920334, 26375003, 32109412, 34671164, 37993712, 37993714
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	29077095, 30692621, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	15123740
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15123740
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23661706
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	7797510
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	TAS	7743998, 7797510
GO:0006954	Process	Inflammatory response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008289	Function	Lipid binding	IDA	25119034, 32510692, 37993712
GO:0009306	Process	Protein secretion	IDA	37993712, 37993714
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	IEA
GO:0016540	Process	Protein autoprocessing	IDA	32109412, 34671164
GO:0016787	Function	Hydrolase activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	16920334
GO:0032991	Component	Protein-containing complex	IEA
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	14528293, 25500532
GO:0042742	Process	Defense response to bacterium	IDA	25119034, 32510692, 37993712, 37993714
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	35114687, 35254907
GO:0045087	Process	Innate immune response	IEA
GO:0050700	Function	CARD domain binding	IPI	16920334
GO:0050727	Process	Regulation of inflammatory response	IDA	32109412
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	33883744
GO:0050729	Process	Positive regulation of inflammatory response	IDA	33377178, 34671164, 37993712, 37993714
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	33377178
GO:0051604	Process	Protein maturation	IDA	25119034, 26375003, 34671164, 37993712, 37993714
GO:0051604	Process	Protein maturation	IDA	25119034, 26375003, 34671164, 37993712, 37993714
GO:0051604	Process	Protein maturation	IEA
GO:0061702	Component	Canonical inflammasome complex	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	15123740
GO:0070269	Process	Pyroptotic inflammatory response	IDA	33883744
GO:0070269	Process	Pyroptotic inflammatory response	IDA	31268602, 32109412, 34671164
GO:0072558	Component	NLRP1 inflammasome complex	IBA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	15123740
GO:0141201	Process	Pyroptotic cell death	IDA	32109412, 38632402
GO:0160074	Component	Non-canonical inflammasome complex	IDA	25119034, 31268602
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	26375003, 34671164
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	25119034, 26375003, 31268602, 32510692, 34671164, 37993712, 37993714
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IDA	16920334
GO:1904646	Process	Cellular response to amyloid-beta	IMP	15123740
GO:2000494	Process	Positive regulation of interleukin-18-mediated signaling pathway	IDA	33377178

MIM	HGNC	e!Ensembl
602664	1505	ENSG00000196954

P49662

Protein name

Caspase-4 (CASP-4) (EC 3.4.22.57) (ICE and Ced-3 homolog 2) (ICH-2) (ICE(rel)-II) (Mih1) (Protease TX) [Cleaved into: Caspase-4 subunit p10; Caspase-4 subunit p20]

Protein function

Inflammatory caspase that acts as the effector of the non-canonical inflammasome by mediating lipopolysaccharide (LPS)-induced pyroptosis (PubMed:25119034, PubMed:26375003, PubMed:32109412, PubMed:34671164, PubMed:37001519, PubMed:37993712, PubM

PDB

6KMZ , 6NRY , 7WR0 , 7WR1 , 7WR4 , 7WR5 , 7WR6 , 8J6K , 8SPB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00619	CARD	3 → 87	Caspase recruitment domain	Domain
PF00656	Peptidase_C14	136 → 373		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, including in keratinocytes and colonic and small intestinal epithelial cells (at protein level). Not detected in brain. {ECO:0000269|PubMed:10986288, ECO:0000269|PubMed:22246630, ECO:0000269|PubMed:25121752, ECO:00002

Sequence

MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN

Sequence length

377

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation NOD-like receptor signaling pathway Pathogenic Escherichia coli infection Shigellosis Salmonella infection		NOD1/2 Signaling Pathway

CASP4 (caspase 4)