Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	837
Gene name Gene Name - the full gene name approved by the HGNC.	Caspase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CASP4
Synonyms (NCBI Gene) Gene synonyms aliases	ICE(rel)II, ICEREL-II, ICH-2, Mih1, Mih1/TX, TX
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prod

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030229	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	25119034, 37993712
GO:0002376	Process	Immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	16920334, 26375003, 32109412, 34671164, 37993712, 37993714
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	29077095, 30692621, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	15123740
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	15123740
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23661706
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	7797510
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	TAS	7743998, 7797510
GO:0006954	Process	Inflammatory response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008289	Function	Lipid binding	IDA	25119034, 32510692, 37993712
GO:0009306	Process	Protein secretion	IDA	37993712, 37993714
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	IEA
GO:0016540	Process	Protein autoprocessing	IDA	32109412, 34671164
GO:0016787	Function	Hydrolase activity	IEA
GO:0032991	Component	Protein-containing complex	IDA	16920334
GO:0032991	Component	Protein-containing complex	IEA
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	14528293, 25500532
GO:0042742	Process	Defense response to bacterium	IDA	25119034, 32510692, 37993712, 37993714
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IBA
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	35114687, 35254907
GO:0045087	Process	Innate immune response	IEA
GO:0050700	Function	CARD domain binding	IPI	16920334
GO:0050727	Process	Regulation of inflammatory response	IDA	32109412
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	33883744
GO:0050729	Process	Positive regulation of inflammatory response	IDA	33377178, 34671164, 37993712, 37993714
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	33377178
GO:0051604	Process	Protein maturation	IDA	25119034, 26375003, 34671164, 37993712, 37993714
GO:0051604	Process	Protein maturation	IDA	25119034, 26375003, 34671164, 37993712, 37993714
GO:0051604	Process	Protein maturation	IEA
GO:0061702	Component	Canonical inflammasome complex	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	15123740
GO:0070269	Process	Pyroptotic inflammatory response	IDA	33883744
GO:0070269	Process	Pyroptotic inflammatory response	IDA	31268602, 32109412, 34671164
GO:0072558	Component	NLRP1 inflammasome complex	IBA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	15123740
GO:0141201	Process	Pyroptotic cell death	IDA	32109412, 38632402
GO:0160074	Component	Non-canonical inflammasome complex	IDA	25119034, 31268602
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	26375003, 34671164
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	25119034, 26375003, 31268602, 32510692, 34671164, 37993712, 37993714
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IDA	16920334
GO:1904646	Process	Cellular response to amyloid-beta	IMP	15123740
GO:2000494	Process	Positive regulation of interleukin-18-mediated signaling pathway	IDA	33377178

MIM	HGNC	e!Ensembl
602664	1505	ENSG00000196954

Protein

UniProt ID

P49662

Protein name

Caspase-4 (CASP-4) (EC 3.4.22.57) (ICE and Ced-3 homolog 2) (ICH-2) (ICE(rel)-II) (Mih1) (Protease TX) [Cleaved into: Caspase-4 subunit p10; Caspase-4 subunit p20]

Protein function

Inflammatory caspase that acts as the effector of the non-canonical inflammasome by mediating lipopolysaccharide (LPS)-induced pyroptosis (PubMed:25119034, PubMed:26375003, PubMed:32109412, PubMed:34671164, PubMed:37001519, PubMed:37993712, PubM

PDB

6KMZ , 6NRY , 7WR0 , 7WR1 , 7WR4 , 7WR5 , 7WR6 , 8J6K , 8SPB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00619	CARD	3 → 87	Caspase recruitment domain	Domain
PF00656	Peptidase_C14	136 → 373		Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, including in keratinocytes and colonic and small intestinal epithelial cells (at protein level). Not detected in brain. {ECO:0000269|PubMed:10986288, ECO:0000269|PubMed:22246630, ECO:0000269|PubMed:25121752, ECO:00002

Sequence

MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN

Sequence length

377

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation NOD-like receptor signaling pathway Pathogenic Escherichia coli infection Shigellosis Salmonella infection		NOD1/2 Signaling Pathway

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Mental Depression	Major depressive disorder	N/A	N/A	GWAS

Show/Hide Text Mining Associations (49)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	15123740
Anodontia	Stimulate	38139378
Aortic Aneurysm Abdominal	Associate	35320939
Aortic Aneurysm Thoracic	Stimulate	15876810
Asthma	Associate	24136334
Bipolar Disorder	Associate	25487697
Breast Neoplasms	Associate	30385776
Carcinogenesis	Associate	30385776
Carcinoma Hepatocellular	Associate	35242200
Carcinoma Non Small Cell Lung	Associate	37194012
Carcinoma Renal Cell	Associate	36647955
Carcinoma Squamous Cell	Associate	21781452, 34517553
Chorioamnionitis	Associate	28122480
Colorectal Neoplasms	Associate	25943872
Death	Associate	21984918
Diabetic Nephropathies	Associate	37316538
Dyskinesias	Associate	21781452
Glioma	Associate	23280445, 36552744
Hypertension	Associate	32664164
Hypotension	Associate	25487697
Inflammation	Associate	20173201, 21984918, 22545106, 25943872, 27624102, 29879455, 34941677, 38139378
Inflammatory Bowel Diseases	Associate	25943872
Kidney Neoplasms	Associate	19603096
Leukemia Lymphocytic Chronic B Cell	Associate	20628148
Lung Diseases	Associate	17586700
Lung Neoplasms	Stimulate	37194012
Lymphatic Metastasis	Associate	37194012
Melanoma	Associate	19383853, 36068291
Mitochondrial Diseases	Stimulate	32733636
Mouth Neoplasms	Associate	21781452
Necrosis	Associate	21984918
Neoplasms	Associate	19106640, 19509549, 21781452, 32682809
Neuroblastoma	Associate	25695505
Neurodegenerative Diseases	Associate	22545106
Obstetric Labor Premature	Associate	28122480
Ovarian Neoplasms	Associate	35778597
Pancreatic Neoplasms	Associate	36199146, 37753069
Periapical Periodontitis	Associate	36359010
Pneumonia	Stimulate	37180156
Pulmonary Disease Chronic Obstructive	Associate	37194062
Rectal Neoplasms	Associate	37144561
Schizophrenia	Associate	25487697
Sepsis	Associate	36250055
Sertoli Cell Only Syndrome	Associate	37296437
Systemic Inflammatory Response Syndrome	Stimulate	37180156
Triple Negative Breast Neoplasms	Associate	21152100, 33297339
Uniparental Disomy	Associate	21152100
Urethral Neoplasms	Associate	22438966
Ventricular Remodeling	Stimulate	32664164

CASP4 (caspase 4)