Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
83604
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 47
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM47
Synonyms (NCBI Gene) Gene synonyms aliases
BCMP1, TM4SF10, VAB-9
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the PMP22/EMP/claudin protein family. The encoded protein is localized to the ER and the plasma membrane. In dogs, transcripts of this gene exist at high levels in the brain. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1114167296 C>G Likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019348 hsa-miR-148b-3p Microarray 17612493
MIRT021761 hsa-miR-132-3p Microarray 17612493
MIRT551874 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT551872 hsa-miR-511-3p HITS-CLIP 21572407
MIRT551871 hsa-miR-496 HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005886 Component Plasma membrane IDA
GO:0005911 Component Cell-cell junction IBA
GO:0005911 Component Cell-cell junction IEA
GO:0005912 Component Adherens junction IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300698 18515 ENSG00000147027
Protein
UniProt ID Q9BQJ4
Protein name Transmembrane protein 47 (Brain cell membrane protein 1) (Transmembrane 4 superfamily member 10)
Protein function Regulates cell junction organization in epithelial cells. May play a role in the transition from adherens junction to tight junction assembly. May regulate F-actin polymerization required for tight junctional localization dynamics and affect the
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in adult brain, fetal brain, cerebellum, heart, lung, prostate and thyroid. {ECO:0000269|PubMed:24603971}.
Sequence
MASAGSGMEEVRVSVLTPLKLVGLVCIFLALCLDLGAVLSPAWVTADHQYYLSLWESCRK
PASLDIWHCESTLSSDWQIATLALLLGGAAIILIAFLVGLISICVGSRRRFYRPVAVMLF
AAVVLQVCSLVLYPIKFIETVSLKIYHEFNWGYGLAWGATIFSFGGAILYCLNPKNYEDY
Y
Sequence length 181
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Brain Diseases Associate 15345028
Breast Neoplasms Associate 28944917, 33745390
Developmental Disabilities Associate 24603971
Melanoma Associate 21606880
Multiple Sclerosis Associate 35561450
Neoplasms Associate 21606880, 32793117
Personality Disorders Associate 28944917
Rhabdomyosarcoma Associate 34285060
Speech Disorders Associate 24603971
Thyroid Neoplasms Associate 32793117