Gene Gene information from NCBI Gene database.
Entrez ID 83593
Gene name Ras association domain family member 5
Gene symbol RASSF5
Synonyms (NCBI Gene)
Maxp1NORE1NORE1ANORE1BRAPLRASSF3
Chromosome 1
Chromosome location 1q32.1
Summary This gene is a member of the Ras association domain family. It functions as a tumor suppressor, and is inactivated in a variety of cancers. The encoded protein localizes to centrosomes and microtubules, and associates with the GTP-activated forms of Ras,
miRNA miRNA information provided by mirtarbase database.
99
miRTarBase ID miRNA Experiments Reference
MIRT002619 hsa-miR-124-3p Microarray 15685193
MIRT017885 hsa-miR-335-5p Microarray 18185580
MIRT002619 hsa-miR-124-3p Microarray 15685193
MIRT002619 hsa-miR-124-3p Microarray 18668037
MIRT023792 hsa-miR-1-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 9488663, 12845325, 15109305, 15569673, 16892067, 17517604, 18596699, 20562859, 20920251, 21988832, 23455922, 23972470, 24255178, 24366813, 24981860, 25416956, 25502805, 26871637, 31515488, 32707033, 32814053, 35271311, 35512704
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607020 17609 ENSG00000266094
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WWW0
Protein name Ras association domain-containing protein 5 (New ras effector 1) (Regulator for cell adhesion and polarization enriched in lymphoid tissues) (RAPL)
Protein function Potential tumor suppressor. Seems to be involved in lymphocyte adhesion by linking RAP1A activation upon T-cell receptor or chemokine stimulation to integrin activation. Isoform 2 stimulates lymphocyte polarization and the patch-like distributio
PDB 4LGD , 4OH8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00130 C1_1 123 173 Phorbol esters/diacylglycerol binding domain (C1 domain) Domain
PF00788 RA 274 364 Ras association (RalGDS/AF-6) domain Domain
PF16517 Nore1-SARAH 371 410 Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Frequently down-regulated in lung tumor cell lines and primary lung tumors. {ECO:0000269|PubMed:11965544, ECO:0000269|PubMed:12676952}.
Sequence
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENET
GEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
Sequence length 418
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Ras signaling pathway
Rap1 signaling pathway
Cellular senescence
Leukocyte transendothelial migration
Pathways in cancer
Non-small cell lung cancer