Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	834
Gene name Gene Name - the full gene name approved by the HGNC.	Caspase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CASP1
Synonyms (NCBI Gene) Gene synonyms aliases	ICE, IL1BC, P45
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo pro

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT642898	hsa-miR-4712-3p	HITS-CLIP	23824327
MIRT642897	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT642896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT642895	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT642894	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT642893	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT642892	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT642891	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT736405	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT642898	hsa-miR-4712-3p	HITS-CLIP	23824327
MIRT642897	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT642896	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT642895	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT642894	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT642893	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT642892	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT642891	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT756228	hsa-miR-370-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36735415

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ETS1	Activation	16103071
TP53	Unknown	11278253

Show/Hide all(98)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	22464733
GO:0001778	Process	Plasma membrane repair	IDA	20530211
GO:0002221	Process	Pattern recognition receptor signaling pathway	NAS	21918512, 22258606, 29196474, 29247998
GO:0004175	Function	Endopeptidase activity	IDA	24548080
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	1574116, 2787508, 9334240, 11821383, 15030775, 15326478, 16920334, 22464733, 32109412, 32553275
GO:0004197	Function	Cysteine-type endopeptidase activity	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IGI	15882992
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	10353249
GO:0005515	Function	Protein binding	IPI	11374873, 11390368, 11432859, 11536016, 12888622, 15030775, 15107016, 15383541, 15817483, 16575408, 16785446, 17360653, 17418785, 18329368, 18511561, 24630722, 25416956, 25605870, 27043298, 29892012, 30692621, 31421660, 32296183, 32814053, 34296442, 34589402
GO:0005730	Component	Nucleolus	NAS	28263976
GO:0005737	Component	Cytoplasm	IDA	20197547
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	19158676, 24803432, 28263976
GO:0005737	Component	Cytoplasm	TAS	22464733
GO:0005829	Component	Cytosol	IDA	20197547
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	NAS	27911804
GO:0005886	Component	Plasma membrane	IEA
GO:0006508	Process	Proteolysis	IDA	12888622, 24548080
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	7876192
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	7876192
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	1373520
GO:0007231	Process	Osmosensory signaling pathway	NAS	22981536
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008656	Function	Cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	10799503
GO:0009306	Process	Protein secretion	IDA	33883744
GO:0016020	Component	Membrane	IEA
GO:0016540	Process	Protein autoprocessing	IDA	11821383, 32109412
GO:0016787	Function	Hydrolase activity	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0019900	Function	Kinase binding	IPI	11432859, 11536016, 15383541
GO:0019955	Function	Cytokine binding	IPI	15030775
GO:0030163	Process	Protein catabolic process	IDA	22464733
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	7642516, 11432859, 11821383, 15030775, 15326478, 16037825, 24630722
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	11536016, 22267217
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISO
GO:0032731	Process	Positive regulation of interleukin-1 beta production	NAS	21918512
GO:0032741	Process	Positive regulation of interleukin-18 production	IDA	15326478
GO:0032991	Component	Protein-containing complex	IDA	16920334
GO:0032991	Component	Protein-containing complex	IEA
GO:0032991	Component	Protein-containing complex	IMP	11536016, 11821383, 15383541
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	14528293
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042802	Function	Identical protein binding	IMP	11432859
GO:0042802	Function	Identical protein binding	IPI	24630722, 27043298
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	22464733
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	15383541
GO:0046456	Process	Icosanoid biosynthetic process	NAS	22902502
GO:0046513	Process	Ceramide biosynthetic process	IDA	17303575
GO:0050700	Function	CARD domain binding	IPI	11821383, 16920334
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IDA	32109412, 32553275
GO:0050729	Process	Positive regulation of inflammatory response	IDA	32109412, 33883744
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12191486, 15326478, 32109412, 32553275
GO:0050729	Process	Positive regulation of inflammatory response	ISO
GO:0050729	Process	Positive regulation of inflammatory response	NAS	21918512, 24630722, 29255148
GO:0051604	Process	Protein maturation	IDA	21157428, 32109412
GO:0051604	Process	Protein maturation	IDA	9334240, 15326478, 22464733, 32109412, 32553275
GO:0051604	Process	Protein maturation	IEA
GO:0051604	Process	Protein maturation	ISS
GO:0051607	Process	Defense response to virus	NAS	28314590
GO:0061702	Component	Canonical inflammasome complex	IPI	16037825
GO:0061702	Component	Canonical inflammasome complex	NAS	25879286
GO:0070212	Process	Protein poly-ADP-ribosylation	IDA	33186521
GO:0070269	Process	Pyroptotic inflammatory response	IDA	33883744, 36227980
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412, 32553275
GO:0070269	Process	Pyroptotic inflammatory response	NAS	19158676, 26121197, 26611636, 29196474
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	1919436, 2950091, 9065432, 9430229, 10854325, 14625308, 20485341
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	22464733
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	22464733
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	11536016
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071346	Process	Cellular response to type II interferon	IMP	11536016
GO:0072557	Component	IPAF inflammasome complex	IBA
GO:0072557	Component	IPAF inflammasome complex	ISS
GO:0072558	Component	NLRP1 inflammasome complex	IDA	12191486
GO:0072558	Component	NLRP1 inflammasome complex	IPI	17349957
GO:0072559	Component	NLRP3 inflammasome complex	IBA
GO:0072559	Component	NLRP3 inflammasome complex	IDA	15030775
GO:0072559	Component	NLRP3 inflammasome complex	IPI	29255148
GO:0097169	Component	AIM2 inflammasome complex	IBA
GO:0097169	Component	AIM2 inflammasome complex	IDA	19158676
GO:0097169	Component	AIM2 inflammasome complex	IPI	24630722
GO:0097179	Component	Protease inhibitor complex	IMP	11432859
GO:0140447	Process	Cytokine precursor processing	IGI	15882992
GO:0140448	Process	Signaling receptor ligand precursor processing	IGI	15882992
GO:0140970	Process	AIM2 inflammasome complex assembly	IDA	19158675
GO:0141201	Process	Pyroptotic cell death	IDA	32109412, 33883744, 36227980, 37198476, 38614101
GO:1903265	Process	Positive regulation of tumor necrosis factor-mediated signaling pathway	IMP	16920334

MIM	HGNC	e!Ensembl
147678	1499	ENSG00000137752

Protein

UniProt ID

P29466

Protein name

Caspase-1 (CASP-1) (EC 3.4.22.36) (Interleukin-1 beta convertase) (IL-1BC) (Interleukin-1 beta-converting enzyme) (ICE) (IL-1 beta-converting enzyme) (p45) [Cleaved into: Caspase-1 subunit p20; Caspase-1 subunit p10]

Protein function

Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer

PDB

1BMQ , 1IBC , 1ICE , 1RWK , 1RWM , 1RWN , 1RWO , 1RWP , 1RWV , 1RWW , 1RWX , 1SC1 , 1SC3 , 1SC4 , 2FQQ , 2H48 , 2H4W , 2H4Y , 2H51 , 2H54 , 2HBQ , 2HBR , 2HBY , 2HBZ , 3D6F , 3D6H , 3D6M , 3E4C , 3NS7 , 5FNA , 5MMV , 5MTK , 6BZ9 , 6F6R , 6KN0 , 6PZP , 6VIE , 7KEU , 8SV1 , 8WRA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00619	CARD	3 → 90	Caspase recruitment domain	Domain
PF00656	Peptidase_C14	163 → 400		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain. {ECO:0000269|PubMed:154984

Sequence

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Sequence length

404

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis Necroptosis Neutrophil extracellular trap formation NOD-like receptor signaling pathway Cytosolic DNA-sensing pathway C-type lectin receptor signaling pathway Amyotrophic lateral sclerosis Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Legionellosis Yersinia infection Influenza A Coronavirus disease - COVID-19 Lipid and atherosclerosis		NOD1/2 Signaling Pathway Interleukin-1 processing TP53 Regulates Transcription of Caspase Activators and Caspases The NLRP3 inflammasome The IPAF inflammasome Interleukin-37 signaling Purinergic signaling in leishmaniasis infection

CASP1 (caspase 1)