Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	822
Gene name Gene Name - the full gene name approved by the HGNC.	Capping actin protein, gelsolin like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CAPG
Synonyms (NCBI Gene) Gene synonyms aliases	AFCP, HEL-S-66, MCP
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001646	hsa-let-7b-5p	pSILAC	18668040
MIRT023906	hsa-miR-1-3p	Microarray	18668037
MIRT025493	hsa-miR-34a-5p	Proteomics	21566225
MIRT001646	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT1955703	hsa-miR-1207-5p	CLIP-seq
MIRT1955704	hsa-miR-1909	CLIP-seq
MIRT1955705	hsa-miR-3665	CLIP-seq
MIRT1955706	hsa-miR-4447	CLIP-seq
MIRT1955707	hsa-miR-4472	CLIP-seq
MIRT1955708	hsa-miR-4736	CLIP-seq
MIRT1955709	hsa-miR-4763-3p	CLIP-seq
MIRT1955710	hsa-miR-486-3p	CLIP-seq
MIRT1955711	hsa-miR-541	CLIP-seq
MIRT1955712	hsa-miR-654-5p	CLIP-seq
MIRT1955713	hsa-miR-939	CLIP-seq
MIRT1955704	hsa-miR-1909	CLIP-seq
MIRT1955705	hsa-miR-3665	CLIP-seq
MIRT2496401	hsa-miR-3919	CLIP-seq
MIRT2496402	hsa-miR-4514	CLIP-seq
MIRT2496403	hsa-miR-4645-5p	CLIP-seq
MIRT2496404	hsa-miR-4673	CLIP-seq
MIRT2496405	hsa-miR-4690-5p	CLIP-seq
MIRT2496406	hsa-miR-4692	CLIP-seq
MIRT1955708	hsa-miR-4736	CLIP-seq
MIRT1955711	hsa-miR-541	CLIP-seq
MIRT1955712	hsa-miR-654-5p	CLIP-seq
MIRT2496407	hsa-miR-940	CLIP-seq
MIRT1955703	hsa-miR-1207-5p	CLIP-seq
MIRT1955704	hsa-miR-1909	CLIP-seq
MIRT1955705	hsa-miR-3665	CLIP-seq
MIRT2496401	hsa-miR-3919	CLIP-seq
MIRT1955706	hsa-miR-4447	CLIP-seq
MIRT1955707	hsa-miR-4472	CLIP-seq
MIRT2496402	hsa-miR-4514	CLIP-seq
MIRT2496403	hsa-miR-4645-5p	CLIP-seq
MIRT2496404	hsa-miR-4673	CLIP-seq
MIRT2496405	hsa-miR-4690-5p	CLIP-seq
MIRT2496406	hsa-miR-4692	CLIP-seq
MIRT1955708	hsa-miR-4736	CLIP-seq
MIRT1955709	hsa-miR-4763-3p	CLIP-seq
MIRT1955710	hsa-miR-486-3p	CLIP-seq
MIRT1955711	hsa-miR-541	CLIP-seq
MIRT1955712	hsa-miR-654-5p	CLIP-seq
MIRT1955713	hsa-miR-939	CLIP-seq
MIRT2496407	hsa-miR-940	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0005515	Function	Protein binding	IPI	18266911, 25416956, 32814053
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IBA	21873635
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005634	Component	Nucleus	IDA	18266911
GO:0005654	Component	Nucleoplasm	IDA	18938132
GO:0005730	Component	Nucleolus	IDA	18938132
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	18266911, 18938132, 19166812, 24236012, 25468996
GO:0005814	Component	Centriole	IDA	19166812
GO:0007417	Process	Central nervous system development	IBA	21873635
GO:0008154	Process	Actin polymerization or depolymerization	IBA	21873635
GO:0008290	Component	F-actin capping protein complex	TAS	1322908
GO:0015629	Component	Actin cytoskeleton	IBA	21873635
GO:0019904	Function	Protein domain specific binding	IPI	18266911
GO:0022617	Process	Extracellular matrix disassembly	IMP	24236012
GO:0030027	Component	Lamellipodium	IEA
GO:0030031	Process	Cell projection assembly	IBA	21873635
GO:0042470	Component	Melanosome	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	18266911
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0051014	Process	Actin filament severing	IBA	21873635
GO:0051015	Function	Actin filament binding	IBA	21873635
GO:0051016	Process	Barbed-end actin filament capping	IBA	21873635
GO:0065003	Process	Protein-containing complex assembly	NAS	1322908
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071803	Process	Positive regulation of podosome assembly	IMP	24236012
GO:0072686	Component	Mitotic spindle	IDA	19166812
GO:0090543	Component	Flemming body	IDA	19166812

MIM	HGNC	e!Ensembl
153615	1474	ENSG00000042493

Protein

UniProt ID

P40121

Protein name

Macrophage-capping protein (Actin regulatory protein CAP-G)

Protein function

Calcium-sensitive protein which reversibly blocks the barbed ends of actin filaments but does not sever preformed actin filaments. May play an important role in macrophage function. May play a role in regulating cytoplasmic and/or nuclear struct

PDB

1J72 , 1JHW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00626	Gelsolin	28 → 107	Gelsolin repeat	Domain
PF00626	Gelsolin	146 → 221	Gelsolin repeat	Domain
PF00626	Gelsolin	264 → 341	Gelsolin repeat	Domain

Tissue specificity

TISSUE SPECIFICITY: Macrophages and macrophage-like cells.

Sequence

MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSH
LHLWIGQQSSRDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VESAFHKTSTGAPAAIKKLYQVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGG
KSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLT
ADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRK
ANEKERQAALQVAEGFISRMQYAPNTQVEILPQGHESPIFKQFFKDWK

Sequence length

348

Interactions

View interactions

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	18206229
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	19381893
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724	15108329
Renal carcinoma	Renal Cell Carcinoma, Conventional (Clear Cell) Renal Cell Carcinoma, Sarcomatoid Renal Cell Carcinoma, Collecting Duct Carcinoma of the Kidney	rs121913668, rs121913670, rs121913243, rs786202724	15108329

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Chromophobe carcinoma	Chromophobe Renal Cell Carcinoma		15108329	ClinVar

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	21908955
Adenolymphoma	Associate	24205396
Adenoma Pleomorphic	Associate	24205396
Autism Spectrum Disorder	Associate	31800155
Breast Neoplasms	Associate	24804218, 26757732, 28791367, 34272498
Carcinogenesis	Associate	24804218, 26663173
Carcinoma Ductal Breast	Associate	35186171
Carcinoma Non Small Cell Lung	Associate	22190510
Carcinoma Renal Cell	Associate	33236143
Colorectal Neoplasms	Stimulate	30155403
Death	Stimulate	22190510
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	24614826
Endometrial Neoplasms	Associate	21305022
Epstein Barr Virus Infections	Inhibit	23534755
Esophageal Squamous Cell Carcinoma	Associate	36072903
Fallopian Tube Neoplasms	Associate	24804218
Glioblastoma	Associate	11300934, 29399702, 30356407, 36114444
Glioblastoma	Stimulate	26663173
Glioma	Associate	26663173
Glioma	Stimulate	29399702
HIV Infections	Associate	30504243
Hodgkin Disease	Associate	36046723
Hypoxia	Stimulate	21908955
Inflammation	Associate	35186171
Leukemia T Cell	Associate	36046723
Lung Neoplasms	Stimulate	21908955
Lymphatic Metastasis	Stimulate	21908955, 33236143
Lymphoma	Associate	34166375
Lymphoma Large B Cell Diffuse	Associate	39261532
Lymphoma Large Cell Anaplastic	Associate	36046723
Motor Neuron Disease	Stimulate	38001563
Mouth Diseases	Associate	18237446
Mucopolysaccharidoses	Associate	32886284
Nasopharyngeal Carcinoma	Associate	36258216
Neoplasm Metastasis	Associate	22190510, 26634544, 26757732, 29399702, 30155403, 33236143, 34272498, 36046723, 37439806
Neoplasms	Stimulate	16847067, 21908955
Neoplasms	Associate	18237446, 22190510, 24804218, 26634544, 30155403, 32309867, 33236143, 35186171, 39683940, 9920419
Neurotoxicity Syndromes	Associate	25084203
Ovarian Neoplasms	Associate	24804218, 35186171
Pancreatic Neoplasms	Associate	16847067
Plaque Atherosclerotic	Associate	34082770
Prostatic Neoplasms	Associate	26634544, 26979803, 27923366
Squamous Cell Carcinoma of Head and Neck	Associate	18237446
Tuberculosis Multidrug Resistant	Stimulate	22190510
Urinary Bladder Neoplasms	Associate	32309867
Uveal melanoma	Associate	9920419

CAPG (capping actin protein, gelsolin like)