Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	81890
Gene name Gene Name - the full gene name approved by the HGNC.	Queuine tRNA-ribosyltransferase catalytic subunit 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	QTRT1
Synonyms (NCBI Gene) Gene synonyms aliases	FP3235, TGT, TGUT
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the catalytic subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRN

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048956	hsa-miR-92a-3p	CLASH	23622248
MIRT621253	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT621252	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT621251	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT621250	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT621249	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT621248	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT621247	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT621253	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT621252	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT621251	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT621250	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT621249	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT621248	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT621247	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT2082811	hsa-miR-1470	CLIP-seq
MIRT2082812	hsa-miR-150	CLIP-seq
MIRT2082813	hsa-miR-4287	CLIP-seq
MIRT2082814	hsa-miR-4469	CLIP-seq
MIRT2082815	hsa-miR-4667-3p	CLIP-seq
MIRT2082816	hsa-miR-4685-3p	CLIP-seq
MIRT2082817	hsa-miR-4713-5p	CLIP-seq
MIRT2082818	hsa-miR-532-3p	CLIP-seq
MIRT2082819	hsa-miR-642a	CLIP-seq
MIRT2082811	hsa-miR-1470	CLIP-seq
MIRT2082812	hsa-miR-150	CLIP-seq
MIRT2082813	hsa-miR-4287	CLIP-seq
MIRT2082814	hsa-miR-4469	CLIP-seq
MIRT2082815	hsa-miR-4667-3p	CLIP-seq
MIRT2082816	hsa-miR-4685-3p	CLIP-seq
MIRT2082817	hsa-miR-4713-5p	CLIP-seq
MIRT2308149	hsa-miR-4749-3p	CLIP-seq
MIRT2082818	hsa-miR-532-3p	CLIP-seq
MIRT2082819	hsa-miR-642a	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002099	Process	TRNA wobble guanine modification	IDA	20354154, 34241577
GO:0002099	Process	TRNA wobble guanine modification	TAS	11255023
GO:0005515	Function	Protein binding	IPI	20354154
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	19414587
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0006400	Process	TRNA modification	IDA	16424344, 37992713
GO:0006400	Process	TRNA modification	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008479	Function	TRNA-guanosine(34) queuine transglycosylase activity	IBA
GO:0008479	Function	TRNA-guanosine(34) queuine transglycosylase activity	IDA	20354154, 34241577
GO:0008479	Function	TRNA-guanosine(34) queuine transglycosylase activity	IEA
GO:0008479	Function	TRNA-guanosine(34) queuine transglycosylase activity	TAS	11255023
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0032473	Component	Cytoplasmic side of mitochondrial outer membrane	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	20354154
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	20354154
GO:0120507	Component	TRNA-guanine transglycosylase complex	IPI	20354154
GO:1990234	Component	Transferase complex	IPI	20354154

MIM	HGNC	e!Ensembl
609615	23797	ENSG00000213339

Protein

UniProt ID

Q9BXR0

Protein name

Queuine tRNA-ribosyltransferase catalytic subunit 1 (EC 2.4.2.64) (Guanine insertion enzyme) (tRNA-guanine transglycosylase)

Protein function

Catalytic subunit of the queuine tRNA-ribosyltransferase (TGT) that catalyzes the base-exchange of a guanine (G) residue with queuine (Q) at position 34 (anticodon wobble position) in tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr),

PDB

6H42 , 6H45 , 7NQ4 , 8OMR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01702	TGT	23 → 382	Queuine tRNA-ribosyltransferase	Family

Sequence

MAGAATQASLESAPRIMRLVAECSRSRARAGELWLPHGTVATPVFMPVGTQATMKGITTE
QLDALGCRICLGNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEV
TEEGVRFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAMYRSIR
WLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRDVPGFAIGGLSGGESKSQFW
RMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQ
LRKKVFEKDFGPIDPECTCPTCQKHSRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAV
RTSIVEKRFPDFVRDFMGAMYGDPTLCPTWATDALASVGITLG

Sequence length

403

Interactions

View interactions

	Reactome
			tRNA modification in the nucleus and cytosol

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Psoriasis	Psoriasis	N/A	N/A	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	N/A	N/A	GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	33633844
Breast Neoplasms	Stimulate	29748526
Carcinogenesis	Associate	11134952
Down Syndrome	Associate	33633844
Essential Tremor	Associate	27990849
Leukemia	Associate	11134952
Neoplasms	Stimulate	11134952
Pancreatic Neoplasms	Associate	7961102

QTRT1 (queuine tRNA-ribosyltransferase catalytic subunit 1)