Gene Gene information from NCBI Gene database.
Entrez ID 81831
Gene name Neuropilin and tolloid like 2
Gene symbol NETO2
Synonyms (NCBI Gene)
BTCL2NEOT2
Chromosome 16
Chromosome location 16q12.1
Summary This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in rats encodes a protein that modulates glutamate signaling in the brain by regulatin
miRNA miRNA information provided by mirtarbase database.
290
miRTarBase ID miRNA Experiments Reference
MIRT002815 hsa-miR-1-3p Luciferase reporter assayMicroarray 15685193
MIRT020025 hsa-miR-375 Microarray 20215506
MIRT002815 hsa-miR-1-3p Microarray 18668037
MIRT002815 hsa-miR-1-3p Microarray 15685193
MIRT030591 hsa-miR-24-3p Microarray 19748357
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32814053
GO:0014069 Component Postsynaptic density IBA
GO:0014069 Component Postsynaptic density IEA
GO:0016020 Component Membrane IEA
GO:0035255 Function Ionotropic glutamate receptor binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607974 14644 ENSG00000171208
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NC67
Protein name Neuropilin and tolloid-like protein 2 (Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2)
Protein function Accessory subunit of neuronal kainate-sensitive glutamate receptors, GRIK2 and GRIK3. Increases kainate-receptor channel activity, slowing the decay kinetics of the receptors, without affecting their expression at the cell surface, and increasin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00431 CUB 45 156 CUB domain Domain
PF00431 CUB 177 289 CUB domain Domain
PF00057 Ldl_recept_a 295 331 Low-density lipoprotein receptor domain class A Repeat
Sequence
MALERLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASP
NYPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKY
SFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLF
TSFVEPPCTSS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHC
KEKKKAGVFEQITKTHGTIIGITSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Sequence length 525
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920943 RCV000149248
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 31514295
Carcinogenesis Associate 33390848
Carcinoma Hepatocellular Associate 40158169
Colorectal Neoplasms Stimulate 26699544, 29297384
Death Stimulate 26699544
Esophageal Neoplasms Associate 33390848
Esophageal Squamous Cell Carcinoma Associate 33006432, 33390848
Glioma Associate 36639372
Hemangioma Associate 19349369
Lymphatic Metastasis Stimulate 26699544, 30770791