Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	81793
Gene name	Toll like receptor 10
Gene symbol	TLR10
Synonyms (NCBI Gene)	CD290
Chromosome	4
Chromosome location	4p14
Summary	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

189

Show/Hide all (189)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049221	hsa-miR-92a-3p	CLASH	23622248
MIRT1426877	hsa-miR-1193	CLIP-seq
MIRT1426878	hsa-miR-122	CLIP-seq
MIRT1426879	hsa-miR-1226	CLIP-seq
MIRT1426880	hsa-miR-1273f	CLIP-seq
MIRT1426881	hsa-miR-1289	CLIP-seq
MIRT1426882	hsa-miR-143	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426885	hsa-miR-3135b	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426887	hsa-miR-3163	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426889	hsa-miR-3198	CLIP-seq
MIRT1426890	hsa-miR-340	CLIP-seq
MIRT1426891	hsa-miR-3652	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426893	hsa-miR-4294	CLIP-seq
MIRT1426894	hsa-miR-4307	CLIP-seq
MIRT1426895	hsa-miR-4309	CLIP-seq
MIRT1426896	hsa-miR-4430	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426898	hsa-miR-4470	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1426900	hsa-miR-4534	CLIP-seq
MIRT1426901	hsa-miR-4695-3p	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426903	hsa-miR-4708-5p	CLIP-seq
MIRT1426904	hsa-miR-4715-3p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426906	hsa-miR-4733-3p	CLIP-seq
MIRT1426907	hsa-miR-4770	CLIP-seq
MIRT1426908	hsa-miR-4772-3p	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426918	hsa-miR-587	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426920	hsa-miR-720	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426922	hsa-miR-891b	CLIP-seq
MIRT1426923	hsa-miR-1185	CLIP-seq
MIRT1426878	hsa-miR-122	CLIP-seq
MIRT1426879	hsa-miR-1226	CLIP-seq
MIRT1426924	hsa-miR-1265	CLIP-seq
MIRT1426925	hsa-miR-2113	CLIP-seq
MIRT1426885	hsa-miR-3135b	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426926	hsa-miR-3605-5p	CLIP-seq
MIRT1426891	hsa-miR-3652	CLIP-seq
MIRT1426927	hsa-miR-3679-5p	CLIP-seq
MIRT1426894	hsa-miR-4307	CLIP-seq
MIRT1426896	hsa-miR-4430	CLIP-seq
MIRT1426898	hsa-miR-4470	CLIP-seq
MIRT1426928	hsa-miR-4474-3p	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1426929	hsa-miR-4529-5p	CLIP-seq
MIRT1426901	hsa-miR-4695-3p	CLIP-seq
MIRT1426906	hsa-miR-4733-3p	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426930	hsa-miR-663b	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426898	hsa-miR-4470	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1920979	hsa-miR-150	CLIP-seq
MIRT1426899	hsa-miR-450b-5p	CLIP-seq
MIRT1920980	hsa-miR-498	CLIP-seq
MIRT1426910	hsa-miR-507	CLIP-seq
MIRT1426912	hsa-miR-548aa	CLIP-seq
MIRT1426913	hsa-miR-548ac	CLIP-seq
MIRT1426914	hsa-miR-548d-3p	CLIP-seq
MIRT1426916	hsa-miR-548z	CLIP-seq
MIRT1426917	hsa-miR-557	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426878	hsa-miR-122	CLIP-seq
MIRT1426879	hsa-miR-1226	CLIP-seq
MIRT1426885	hsa-miR-3135b	CLIP-seq
MIRT1426891	hsa-miR-3652	CLIP-seq
MIRT1426896	hsa-miR-4430	CLIP-seq
MIRT1426901	hsa-miR-4695-3p	CLIP-seq
MIRT1426906	hsa-miR-4733-3p	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426877	hsa-miR-1193	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq
MIRT1426877	hsa-miR-1193	CLIP-seq
MIRT1426883	hsa-miR-197	CLIP-seq
MIRT1426884	hsa-miR-2392	CLIP-seq
MIRT1426886	hsa-miR-3149	CLIP-seq
MIRT1426888	hsa-miR-3187-3p	CLIP-seq
MIRT1426892	hsa-miR-411	CLIP-seq
MIRT1426897	hsa-miR-4435	CLIP-seq
MIRT1426902	hsa-miR-4701-5p	CLIP-seq
MIRT1426905	hsa-miR-4716-5p	CLIP-seq
MIRT1426931	hsa-miR-4735-5p	CLIP-seq
MIRT1426932	hsa-miR-4775	CLIP-seq
MIRT1426909	hsa-miR-4781-3p	CLIP-seq
MIRT1426911	hsa-miR-5096	CLIP-seq
MIRT1426915	hsa-miR-548s	CLIP-seq
MIRT1426919	hsa-miR-588	CLIP-seq
MIRT1426933	hsa-miR-590-3p	CLIP-seq
MIRT1426921	hsa-miR-767-5p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
FOXP3	Unknown	17641056
RXRA	Unknown	24373795
VDR	Unknown	24373795

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002224	Process	Toll-like receptor signaling pathway	IBA
GO:0002224	Process	Toll-like receptor signaling pathway	IEA
GO:0002224	Process	Toll-like receptor signaling pathway	ISS
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	11267672
GO:0005515	Function	Protein binding	IPI	15728506, 23155421, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	33576548
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	11267672
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	11267672
GO:0035663	Function	Toll-like receptor 2 binding	IBA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0042802	Function	Identical protein binding	IPI	15728506, 23155421
GO:0043235	Component	Receptor complex	IEA
GO:0043235	Component	Receptor complex	IPI	23155421
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	33576548
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0071221	Process	Cellular response to bacterial lipopeptide	IBA
GO:0071723	Function	Lipopeptide binding	IBA

MIM	HGNC	e!Ensembl
606270	15634	ENSG00000174123

Q9BXR5

Protein name

Toll-like receptor 10 (CD antigen CD290)

Protein function

Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response (By similarity).

PDB

2J67

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00560	LRR_1	50 → 71	Leucine Rich Repeat	Repeat
PF13855	LRR_8	72 → 129	Leucine rich repeat	Repeat
PF01582	TIR	633 → 802	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.

Sequence

MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE
NAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE
NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWANLRAAINVNVL
ATREMYELQTFTELNEESRGSTISLMRTDCL

Sequence length

811

Interactions

View interactions

	Reactome
			Toll Like Receptor 10 (TLR10) Cascade IRAK4 deficiency (TLR5) MyD88 cascade initiated on plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANTI-TOPOISOMERASE-I-ANTIBODY-POSITIVE SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (65)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	32345670	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Stimulate	37746997	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	38256138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	17652175	★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Associate	24336024	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	27716427, 30686934, 31376255, 32365786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	19247692, 28592890	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Associate	20618976, 31789409	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Associate	28592890	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Associate	20826912	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Associate	12689944	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	33907270	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	36012132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Associate	31272954	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	29566186	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Band Shaped	Associate	31272954	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	38296538	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Stimulate	29428931	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	36552771	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	28368946, 28699598, 32719215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	32287174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	32287174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Associate	25028161	★★★★★ ★☆☆☆☆ Found in Text Mining only
Helicobacter Infections	Associate	26559190, 28368946, 34420402, 34521966	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	30930906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyper IgM Immunodeficiency Syndrome Type 1	Associate	28699598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ige Responsiveness Atopic	Associate	27498757	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	38296538	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	28699598, 30686934, 31789409, 32597225, 36012132	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	30618413, 36671404	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	36969199	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Pulmonary Aspergillosis	Inhibit	24712925	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Associate	21478107	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Associate	34695167	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia B Cell	Associate	12689944	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	21750087	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	32287174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic T Cell	Associate	19036098	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lichenoid Eruptions	Associate	28715461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	21886837	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Inhibit	40011954	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	32287174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell Marginal Zone	Associate	26294727	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Associate	12689944	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	32287174	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	19029192	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Associate	28699598	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Associate	20406964	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Associate	38256138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	12689944, 20629663	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	29381915	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	35937402, 37624966	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Stimulate	29428931	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Associate	36969199	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Associate	29194748	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Associate	29194748, 29980729	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peptic Ulcer	Associate	26559190, 32719215, 34420402	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	30618413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Associate	36671404	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Associate	20815312, 28228119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	32719215	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26559190	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis Pulmonary	Associate	34275341	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	39208235	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Associate	31272954	★★★★★ ★☆☆☆☆ Found in Text Mining only

TLR10 (toll like receptor 10)