Gene Gene information from NCBI Gene database.
Entrez ID 81628
Gene name TSC22 domain family member 4
Gene symbol TSC22D4
Synonyms (NCBI Gene)
SPACDRTHG-1THG1TILZ2
Chromosome 7
Chromosome location 7q22.1
Summary TSC22D4 is a member of the TSC22 domain family of leucine zipper transcriptional regulators (see TSC22D3; MIM 300506) (Kester et al., 1999 [PubMed 10488076]; Fiorenza et al., 2001 [PubMed 11707329]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
98
miRTarBase ID miRNA Experiments Reference
MIRT004100 hsa-miR-124-3p Microarray 15685193
MIRT004100 hsa-miR-124-3p Microarray 18668037
MIRT004100 hsa-miR-124-3p Microarray 15685193
MIRT025708 hsa-miR-7-5p Sequencing 20371350
MIRT030651 hsa-miR-22-3p Sequencing 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0005515 Function Protein binding IPI 16189514, 16713569, 19615732, 21448135, 21516116, 21988832, 22510880, 25416956, 28514442, 31515488, 32296183, 32707033, 32814053, 33961781, 35271311
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus ISS
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611914 21696 ENSG00000166925
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y3Q8
Protein name TSC22 domain family protein 4 (TSC22-related-inducible leucine zipper protein 2)
Protein function Binds DNA and acts as a transcriptional repressor (PubMed:10488076). Involved in the regulation of systematic glucose homeostasis and insulin sensitivity, via transcriptional repression of downstream insulin signaling targets such as OBP2A/LCN13
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01166 TSC22 326 381 TSC-22/dip/bun family Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in the liver. {ECO:0000269|PubMed:27827363}.
Sequence
MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRN
GSPPPGAPSSRFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAG
GRSLDSRLELASLGLGAPTPPSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAK
AEKPPLSASSPQQRPPEPETGESAGTSRAATPLPSLRVEAEAGGSGARTPPLSRRKAVDM
RLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSPDPFGAVAAQKFSLAHSMLAI
SGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRELAERNAALEQ
ENGLLRALASPEQLAQLPSSG
VPRLGPPAPNGPSV
Sequence length 395
Interactions View interactions