TMEM163 (transmembrane protein 163)

Gene

• Entrez ID: 81615
• Gene name: Transmembrane protein 163
• Gene symbol: TMEM163
• Synonyms (NCBI Gene): DC29, HLD25, SLC30A11, SV31
• Chromosome: 2
• Chromosome location: 2q21.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017779	hsa-miR-335-5p	Microarray	18185580
MIRT641381	hsa-miR-1255b-2-3p	HITS-CLIP	23824327
MIRT641381	hsa-miR-1255b-2-3p	HITS-CLIP	23824327
MIRT1431799	hsa-miR-125a-3p	CLIP-seq
MIRT1431800	hsa-miR-1271	CLIP-seq
MIRT1431801	hsa-miR-3156-5p	CLIP-seq
MIRT1431802	hsa-miR-3650	CLIP-seq
MIRT1431803	hsa-miR-3665	CLIP-seq
MIRT1431804	hsa-miR-3927	CLIP-seq
MIRT1431805	hsa-miR-4488	CLIP-seq
MIRT1431806	hsa-miR-4519	CLIP-seq
MIRT1431807	hsa-miR-4695-3p	CLIP-seq
MIRT1431808	hsa-miR-4697-5p	CLIP-seq
MIRT1431809	hsa-miR-4736	CLIP-seq
MIRT1431810	hsa-miR-4793-5p	CLIP-seq
MIRT1431811	hsa-miR-660	CLIP-seq
MIRT1431812	hsa-miR-935	CLIP-seq
MIRT1431813	hsa-miR-96	CLIP-seq
MIRT2129445	hsa-miR-1910	CLIP-seq
MIRT2129446	hsa-miR-193a-5p	CLIP-seq
MIRT2129447	hsa-miR-3689d	CLIP-seq
MIRT2129448	hsa-miR-4264	CLIP-seq
MIRT2129449	hsa-miR-4527	CLIP-seq
MIRT2129450	hsa-miR-455-3p	CLIP-seq
MIRT2129451	hsa-miR-4717-3p	CLIP-seq
MIRT2129452	hsa-miR-4802-3p	CLIP-seq
MIRT2129453	hsa-miR-490-5p	CLIP-seq
MIRT2129454	hsa-miR-767-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25130899, 36204728
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	ISS
GO:0016020	Component	Membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IBA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0031902	Component	Late endosome membrane	IEA
GO:0042552	Process	Myelination	IMP	35455965
GO:0045202	Component	Synapse	IEA
GO:0071577	Process	Zinc ion transmembrane transport	IEA
GO:0099180	Process	Zinc ion import into synaptic vesicle	IEA
GO:0140882	Process	Zinc export across plasma membrane	IDA	31697912

Other IDs

• MIM: 618978
• HGNC: 25380
• e!Ensembl: ENSG00000152128

Protein

• UniProt ID: Q8TC26
• Protein name: Transmembrane protein 163
• Protein function: Zinc ion transporter that mediates zinc efflux and plays a crucial role in intracellular zinc homeostasis (PubMed:25130899, PubMed:31697912, PubMed:36204728). Binds the divalent cations Zn(2+), Ni(2+), and to a minor extent Cu(2+) (By similarity
• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. High expression is detected in brain, lung and testis. {ECO:0000269|PubMed:25130899}.
• Sequence:

  MEPAAGIQRRSSQGPTVPPPPRGHAPPAAAPGPAPLSSPVREPPQLEEERQVRISESGQF
  SDGLEDRGLLESSTRLKPHEAQNYRKKALWVSWFSIIVTLALAVAAFTVSVMRYSASAFG
  FAFDAILDVLSSAIVLWRYSNAAAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTR
  LLPEVDDFLFSVSILSGILCSILAVLKFMLGKVLTSRALITDGFNSLVGGVMGFSILLSA
  EVFKHDSAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE

• Sequence length: 289

Associated diseases

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Leukodystrophy, hypomyelinating, 25	Likely pathogenic; Pathogenic	rs2467325671, rs2468508886, rs2468508848	RCV003152356 RCV003152357 RCV003152358 RCV003152359

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Associate	35205284
Carcinoma Pancreatic Ductal	Associate	33574088
Diabetes Mellitus Type 2	Associate	26290879
Parkinson Disease	Associate	27393345, 33523105