Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81615
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 163
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM163
Synonyms (NCBI Gene) Gene synonyms aliases
DC29, HLD25, SLC30A11, SV31
Disease Acronyms (UniProt) Disease acronyms from UniProt database
HLD25
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q21.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017779 hsa-miR-335-5p Microarray 18185580
MIRT641381 hsa-miR-1255b-2-3p HITS-CLIP 23824327
MIRT641381 hsa-miR-1255b-2-3p HITS-CLIP 23824327
MIRT1431799 hsa-miR-125a-3p CLIP-seq
MIRT1431800 hsa-miR-1271 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0008270 Function Zinc ion binding IBA 21873635
GO:0008270 Function Zinc ion binding ISS
GO:0016020 Component Membrane IBA 21873635
GO:0030285 Component Integral component of synaptic vesicle membrane IBA 21873635
GO:0030285 Component Integral component of synaptic vesicle membrane ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618978 25380 ENSG00000152128
Protein
UniProt ID Q8TC26
Protein name Transmembrane protein 163
Protein function Zinc ion transporter that mediates zinc efflux and plays a crucial role in intracellular zinc homeostasis (PubMed:25130899, PubMed:31697912, PubMed:36204728). Binds the divalent cations Zn(2+), Ni(2+), and to a minor extent Cu(2+) (By similarity
Family and domains
Tissue specificity TISSUE SPECIFICITY: Widely expressed. High expression is detected in brain, lung and testis. {ECO:0000269|PubMed:25130899}.
Sequence
MEPAAGIQRRSSQGPTVPPPPRGHAPPAAAPGPAPLSSPVREPPQLEEERQVRISESGQF
SDGLEDRGLLESSTRLKPHEAQNYRKKALWVSWFSIIVTLALAVAAFTVSVMRYSASAFG
FAFDAILDVLSSAIVLWRYSNAAAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTR
LLPEVDDFLFSVSILSGILCSILAVLKFMLGKVLTSRALITDGFNSLVGGVMGFSILLSA
EVFKHDSAVWYLDGSIGVLIGLTIFAYGVKLLIDMVPRVRQTRHYEMFE
Sequence length 289
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 17634449
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
23209189
Unknown
Disease term Disease name Evidence References Source
Leukodystrophy leukodystrophy, hypomyelinating, 25 GenCC
Neuroticism Neuroticism GWAS
Diabetes Diabetes GWAS
Biliary Cholangitis Biliary Cholangitis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35205284
Carcinoma Pancreatic Ductal Associate 33574088
Diabetes Mellitus Type 2 Associate 26290879
Parkinson Disease Associate 27393345, 33523105