Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81575
Gene name Gene Name - the full gene name approved by the HGNC.
Apolipoprotein L domain containing 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
APOLD1
Synonyms (NCBI Gene) Gene synonyms aliases
BDVAS, VERGE
Disease Acronyms (UniProt) Disease acronyms from UniProt database
BDVAS
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
APOLD1 is an endothelial cell early response protein that may play a role in regulation of endothelial cell signaling and vascular function (Regard et al., 2004 [PubMed 15102925]).[supplied by OMIM, Dec 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016472 hsa-miR-193b-3p Microarray 20304954
MIRT024460 hsa-miR-215-5p Microarray 19074876
MIRT026548 hsa-miR-192-5p Microarray 19074876
MIRT030891 hsa-miR-21-5p Microarray 18591254
MIRT049116 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IBA 21873635
GO:0001666 Process Response to hypoxia IEA
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IEA
GO:0006869 Process Lipid transport IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612456 25268 ENSG00000178878
Protein
UniProt ID Q96LR9
Protein name Apolipoprotein L domain-containing protein 1 (Vascular early response gene protein)
Protein function Is a modulator of endothelial barrier permeability, required for proper organization of endothelial cell-cell junctions and cytoskeleton (PubMed:35638551). It also plays a role in the modulation of secretory autophagy (PubMed:35638551). May affe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05461 ApoL 55 174 Apolipoprotein L Family
Tissue specificity TISSUE SPECIFICITY: Expressed in neonatal dermal microvascular endothelial cells. {ECO:0000269|PubMed:15102925}.
Sequence
MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRG
RLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSA
VGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCR
WQGCGD
RQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESC
TGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
Sequence length 279
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Prostate carcinoma rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 31562322
Unknown
Disease term Disease name Evidence References Source
Atrial Fibrillation Atrial Fibrillation GWAS
Associations from Text Mining
Disease Name Relationship Type References
Blood Coagulation Disorders Inherited Associate 35638551
Carcinoma Renal Cell Associate 32883362
Hemorrhagic Disorders Associate 35638551
Hypoxia Associate 24114211
Neoplasms Germ Cell and Embryonal Associate 20051947
Osteoarthritis Associate 35733917
Vascular Diseases Associate 35638551