Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
81565
Gene name Gene Name - the full gene name approved by the HGNC.
NudE neurodevelopment protein 1 like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NDEL1
Synonyms (NCBI Gene) Gene synonyms aliases
EOPA, MITAP1, NDE1L1, NDE2, NUDEL
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020142 hsa-miR-130b-3p Sequencing 20371350
MIRT027032 hsa-miR-103a-3p Sequencing 20371350
MIRT027990 hsa-miR-93-5p Sequencing 20371350
MIRT028403 hsa-miR-30a-5p Proteomics 18668040
MIRT031092 hsa-miR-19b-3p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000132 Process Establishment of mitotic spindle orientation IBA
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0000775 Component Chromosome, centromeric region IEA
GO:0000776 Component Kinetochore IBA
GO:0000776 Component Kinetochore IDA 17600710
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607538 17620 ENSG00000166579
Protein
UniProt ID Q9GZM8
Protein name Nuclear distribution protein nudE-like 1 (Protein Nudel) (Mitosin-associated protein 1)
Protein function Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positive
PDB 2V66
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04880 NUDE_C 135 309 NUDE protein, C-terminal conserved region Family
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:16005531}.
Sequence
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQ
RNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQ
ANDDLERAKRATIVSLEDFEQRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQE
LAVRERQQEVTRKSAPSSPTLDCEKMDSAVQASLSLPATPVGKGTENTFPSPKAIPNGFG
TSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQASRKSYISGNVNCGVLNGNG
TKFSRSGHT
SFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLSV
Sequence length 345
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anencephaly Associate 24634123
Behcet Syndrome Stimulate 27701407
Classical Lissencephalies and Subcortical Band Heterotopias Associate 17997972, 38194050
Congenital Abnormalities Associate 24634123
Head and Neck Neoplasms Associate 32717241
Lissencephaly Associate 20168084, 38194050
Malformations of Cortical Development Associate 38194050
Psychotic Disorders Associate 27701407
Sarcoma Kaposi Associate 38194050
Schizophrenia Associate 19251251, 21998303, 29142105