Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	81559
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM11
Synonyms (NCBI Gene) Gene synonyms aliases	BIA1, RNF92
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q42.13
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cyto

Show/Hide all(87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050803	hsa-miR-17-5p	CLASH	23622248
MIRT1452896	hsa-miR-1178	CLIP-seq
MIRT1452897	hsa-miR-1208	CLIP-seq
MIRT1452898	hsa-miR-1253	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT1452900	hsa-miR-193a-3p	CLIP-seq
MIRT1452901	hsa-miR-193b	CLIP-seq
MIRT1452902	hsa-miR-2355-5p	CLIP-seq
MIRT1452903	hsa-miR-3132	CLIP-seq
MIRT1452904	hsa-miR-3909	CLIP-seq
MIRT1452905	hsa-miR-3921	CLIP-seq
MIRT1452906	hsa-miR-4251	CLIP-seq
MIRT1452907	hsa-miR-4252	CLIP-seq
MIRT1452908	hsa-miR-4326	CLIP-seq
MIRT1452909	hsa-miR-4329	CLIP-seq
MIRT1452910	hsa-miR-4421	CLIP-seq
MIRT1452911	hsa-miR-4433	CLIP-seq
MIRT1452912	hsa-miR-4451	CLIP-seq
MIRT1452913	hsa-miR-4653-5p	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT1452915	hsa-miR-4733-3p	CLIP-seq
MIRT1452916	hsa-miR-4786-3p	CLIP-seq
MIRT1452917	hsa-miR-665	CLIP-seq
MIRT2135658	hsa-miR-1248	CLIP-seq
MIRT2135659	hsa-miR-1285	CLIP-seq
MIRT2135660	hsa-miR-1299	CLIP-seq
MIRT2135661	hsa-miR-140-3p	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT2135662	hsa-miR-1972	CLIP-seq
MIRT1452902	hsa-miR-2355-5p	CLIP-seq
MIRT1452903	hsa-miR-3132	CLIP-seq
MIRT2135663	hsa-miR-3155	CLIP-seq
MIRT2135664	hsa-miR-3155b	CLIP-seq
MIRT2135665	hsa-miR-3182	CLIP-seq
MIRT2135666	hsa-miR-3187-5p	CLIP-seq
MIRT2135667	hsa-miR-3194-3p	CLIP-seq
MIRT2135668	hsa-miR-3617	CLIP-seq
MIRT2135669	hsa-miR-3674	CLIP-seq
MIRT2135670	hsa-miR-3677-5p	CLIP-seq
MIRT2135671	hsa-miR-3686	CLIP-seq
MIRT2135672	hsa-miR-3691-3p	CLIP-seq
MIRT2135673	hsa-miR-378g	CLIP-seq
MIRT2135674	hsa-miR-4297	CLIP-seq
MIRT2135675	hsa-miR-4314	CLIP-seq
MIRT2135676	hsa-miR-4437	CLIP-seq
MIRT1452912	hsa-miR-4451	CLIP-seq
MIRT2135677	hsa-miR-4486	CLIP-seq
MIRT2135678	hsa-miR-4659a-3p	CLIP-seq
MIRT2135679	hsa-miR-4659b-3p	CLIP-seq
MIRT2135680	hsa-miR-4674	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT2135681	hsa-miR-4722-3p	CLIP-seq
MIRT2135682	hsa-miR-4726-3p	CLIP-seq
MIRT2135683	hsa-miR-4742-3p	CLIP-seq
MIRT2135684	hsa-miR-4778-3p	CLIP-seq
MIRT2135685	hsa-miR-4782-5p	CLIP-seq
MIRT2135686	hsa-miR-484	CLIP-seq
MIRT2135687	hsa-miR-516b	CLIP-seq
MIRT2135688	hsa-miR-558	CLIP-seq
MIRT2135689	hsa-miR-561	CLIP-seq
MIRT2135690	hsa-miR-612	CLIP-seq
MIRT2135691	hsa-miR-641	CLIP-seq
MIRT2135692	hsa-miR-760	CLIP-seq
MIRT2135693	hsa-miR-767-3p	CLIP-seq
MIRT2135694	hsa-miR-875-3p	CLIP-seq
MIRT2356867	hsa-miR-124	CLIP-seq
MIRT2356868	hsa-miR-1297	CLIP-seq
MIRT2356869	hsa-miR-148a	CLIP-seq
MIRT2356870	hsa-miR-148b	CLIP-seq
MIRT2356871	hsa-miR-152	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT2135662	hsa-miR-1972	CLIP-seq
MIRT2356872	hsa-miR-22	CLIP-seq
MIRT2356873	hsa-miR-24	CLIP-seq
MIRT2356874	hsa-miR-26a	CLIP-seq
MIRT2356875	hsa-miR-26b	CLIP-seq
MIRT2356876	hsa-miR-3169	CLIP-seq
MIRT2356877	hsa-miR-4254	CLIP-seq
MIRT2356878	hsa-miR-4465	CLIP-seq
MIRT2356879	hsa-miR-4519	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT2356880	hsa-miR-506	CLIP-seq
MIRT2356881	hsa-miR-548an	CLIP-seq
MIRT2135688	hsa-miR-558	CLIP-seq
MIRT2650248	hsa-miR-4269	CLIP-seq
MIRT2650249	hsa-miR-4645-5p	CLIP-seq
MIRT2650250	hsa-miR-4673	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16904669
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	18248090
GO:0005829	Component	Cytosol	IDA
GO:0008134	Function	Transcription factor binding	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0032897	Process	Negative regulation of viral transcription	IDA	18248090
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IMP	18248090
GO:0045892	Process	Negative regulation of transcription, DNA-templated	IEA
GO:0046597	Process	Negative regulation of viral entry into host cell	IMP	18248090
GO:0046598	Process	Positive regulation of viral entry into host cell	IMP	18248090
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:1902187	Process	Negative regulation of viral release from host cell	IDA	18248090
GO:1902187	Process	Negative regulation of viral release from host cell	IMP	18248090

MIM	HGNC	e!Ensembl
607868	16281	ENSG00000154370

Protein

UniProt ID

Q96F44

Protein name

E3 ubiquitin-protein ligase TRIM11 (EC 2.3.2.27) (Protein BIA1) (RING finger protein 92) (Tripartite motif-containing protein 11)

Protein function

E3 ubiquitin-protein ligase that promotes the degradation of insoluble ubiquitinated proteins, including insoluble PAX6, poly-Gln repeat expanded HTT and poly-Ala repeat expanded ARX (By similarity). Mediates PAX6 ubiquitination leading to prote

PDB

7QS1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	16 → 56		Domain
PF00643	zf-B_box	87 → 128	B-box zinc finger	Domain
PF13765	PRY	289 → 337	SPRY-associated domain	Family
PF00622	SPRY	341 → 451	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000305|PubMed:16904669}.

Sequence

MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLG
EFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIAELEGRCQLPA
LGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPEL
ILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCR
ENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ

Sequence length

468

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

TRIM11 (tripartite motif containing 11)