Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	81559
Gene name	Tripartite motif containing 11
Gene symbol	TRIM11
Synonyms (NCBI Gene)	BIA1RNF92
Chromosome	1
Chromosome location	1q42.13
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cyto

Show/Hide all (87)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050803	hsa-miR-17-5p	CLASH	23622248
MIRT1452896	hsa-miR-1178	CLIP-seq
MIRT1452897	hsa-miR-1208	CLIP-seq
MIRT1452898	hsa-miR-1253	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT1452900	hsa-miR-193a-3p	CLIP-seq
MIRT1452901	hsa-miR-193b	CLIP-seq
MIRT1452902	hsa-miR-2355-5p	CLIP-seq
MIRT1452903	hsa-miR-3132	CLIP-seq
MIRT1452904	hsa-miR-3909	CLIP-seq
MIRT1452905	hsa-miR-3921	CLIP-seq
MIRT1452906	hsa-miR-4251	CLIP-seq
MIRT1452907	hsa-miR-4252	CLIP-seq
MIRT1452908	hsa-miR-4326	CLIP-seq
MIRT1452909	hsa-miR-4329	CLIP-seq
MIRT1452910	hsa-miR-4421	CLIP-seq
MIRT1452911	hsa-miR-4433	CLIP-seq
MIRT1452912	hsa-miR-4451	CLIP-seq
MIRT1452913	hsa-miR-4653-5p	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT1452915	hsa-miR-4733-3p	CLIP-seq
MIRT1452916	hsa-miR-4786-3p	CLIP-seq
MIRT1452917	hsa-miR-665	CLIP-seq
MIRT2135658	hsa-miR-1248	CLIP-seq
MIRT2135659	hsa-miR-1285	CLIP-seq
MIRT2135660	hsa-miR-1299	CLIP-seq
MIRT2135661	hsa-miR-140-3p	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT2135662	hsa-miR-1972	CLIP-seq
MIRT1452902	hsa-miR-2355-5p	CLIP-seq
MIRT1452903	hsa-miR-3132	CLIP-seq
MIRT2135663	hsa-miR-3155	CLIP-seq
MIRT2135664	hsa-miR-3155b	CLIP-seq
MIRT2135665	hsa-miR-3182	CLIP-seq
MIRT2135666	hsa-miR-3187-5p	CLIP-seq
MIRT2135667	hsa-miR-3194-3p	CLIP-seq
MIRT2135668	hsa-miR-3617	CLIP-seq
MIRT2135669	hsa-miR-3674	CLIP-seq
MIRT2135670	hsa-miR-3677-5p	CLIP-seq
MIRT2135671	hsa-miR-3686	CLIP-seq
MIRT2135672	hsa-miR-3691-3p	CLIP-seq
MIRT2135673	hsa-miR-378g	CLIP-seq
MIRT2135674	hsa-miR-4297	CLIP-seq
MIRT2135675	hsa-miR-4314	CLIP-seq
MIRT2135676	hsa-miR-4437	CLIP-seq
MIRT1452912	hsa-miR-4451	CLIP-seq
MIRT2135677	hsa-miR-4486	CLIP-seq
MIRT2135678	hsa-miR-4659a-3p	CLIP-seq
MIRT2135679	hsa-miR-4659b-3p	CLIP-seq
MIRT2135680	hsa-miR-4674	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT2135681	hsa-miR-4722-3p	CLIP-seq
MIRT2135682	hsa-miR-4726-3p	CLIP-seq
MIRT2135683	hsa-miR-4742-3p	CLIP-seq
MIRT2135684	hsa-miR-4778-3p	CLIP-seq
MIRT2135685	hsa-miR-4782-5p	CLIP-seq
MIRT2135686	hsa-miR-484	CLIP-seq
MIRT2135687	hsa-miR-516b	CLIP-seq
MIRT2135688	hsa-miR-558	CLIP-seq
MIRT2135689	hsa-miR-561	CLIP-seq
MIRT2135690	hsa-miR-612	CLIP-seq
MIRT2135691	hsa-miR-641	CLIP-seq
MIRT2135692	hsa-miR-760	CLIP-seq
MIRT2135693	hsa-miR-767-3p	CLIP-seq
MIRT2135694	hsa-miR-875-3p	CLIP-seq
MIRT2356867	hsa-miR-124	CLIP-seq
MIRT2356868	hsa-miR-1297	CLIP-seq
MIRT2356869	hsa-miR-148a	CLIP-seq
MIRT2356870	hsa-miR-148b	CLIP-seq
MIRT2356871	hsa-miR-152	CLIP-seq
MIRT1452899	hsa-miR-1915	CLIP-seq
MIRT2135662	hsa-miR-1972	CLIP-seq
MIRT2356872	hsa-miR-22	CLIP-seq
MIRT2356873	hsa-miR-24	CLIP-seq
MIRT2356874	hsa-miR-26a	CLIP-seq
MIRT2356875	hsa-miR-26b	CLIP-seq
MIRT2356876	hsa-miR-3169	CLIP-seq
MIRT2356877	hsa-miR-4254	CLIP-seq
MIRT2356878	hsa-miR-4465	CLIP-seq
MIRT2356879	hsa-miR-4519	CLIP-seq
MIRT1452914	hsa-miR-4691-5p	CLIP-seq
MIRT2356880	hsa-miR-506	CLIP-seq
MIRT2356881	hsa-miR-548an	CLIP-seq
MIRT2135688	hsa-miR-558	CLIP-seq
MIRT2650248	hsa-miR-4269	CLIP-seq
MIRT2650249	hsa-miR-4645-5p	CLIP-seq
MIRT2650250	hsa-miR-4673	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	27498865
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	16904669
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18248090
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016567	Process	Protein ubiquitination	IDA	27498865
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	27498865
GO:0032897	Process	Negative regulation of viral transcription	IBA
GO:0032897	Process	Negative regulation of viral transcription	IDA	18248090
GO:0032897	Process	Negative regulation of viral transcription	IEA
GO:0044790	Process	Suppression of viral release by host	IBA
GO:0044790	Process	Suppression of viral release by host	IDA	18248090
GO:0044790	Process	Suppression of viral release by host	IEA
GO:0044790	Process	Suppression of viral release by host	IMP	18248090
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	IMP	18248090
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IBA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IMP	18248090
GO:0046598	Process	Positive regulation of viral entry into host cell	IEA
GO:0046598	Process	Positive regulation of viral entry into host cell	IMP	18248090
GO:0046872	Function	Metal ion binding	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0051865	Process	Protein autoubiquitination	IDA	27498865
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0140972	Process	Negative regulation of AIM2 inflammasome complex assembly	IDA	27498865

MIM	HGNC	e!Ensembl
607868	16281	ENSG00000154370

Q96F44

Protein name

E3 ubiquitin-protein ligase TRIM11 (EC 2.3.2.27) (Protein BIA1) (RING finger protein 92) (Tripartite motif-containing protein 11)

Protein function

E3 ubiquitin-protein ligase that promotes the degradation of insoluble ubiquitinated proteins, including insoluble PAX6, poly-Gln repeat expanded HTT and poly-Ala repeat expanded ARX (By similarity). Mediates PAX6 ubiquitination leading to prote

PDB

7QS1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	16 → 56		Domain
PF00643	zf-B_box	87 → 128	B-box zinc finger	Domain
PF13765	PRY	289 → 337	SPRY-associated domain	Family
PF00622	SPRY	341 → 451	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000305|PubMed:16904669}.

Sequence

MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLG
EFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIAELEGRCQLPA
LGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTANPEL
ILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWALGVCR
ENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLSFYSA
TDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ

Sequence length

468

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer's disease without Neurofibrillary tangles	Associate	32142177	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Stimulate	32599554	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	37604203	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	33173411	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Associate	31860007	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Neurofibrillary Tangles with Calcification	Associate	32142177	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	27329103	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	27329103	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	36376537	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	30563406, 30608062, 35751643, 36376537	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	30608062	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reperfusion Injury	Stimulate	34694031	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	33099959	★★★★★ ★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Associate	30066433, 31860007, 32142177, 35384155, 39260141	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM11 (tripartite motif containing 11)