Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8131
Gene name Gene Name - the full gene name approved by the HGNC.
NPR3 like, GATOR1 complex subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NPRL3
Synonyms (NCBI Gene) Gene synonyms aliases
C16orf35, CGTHBA, FFEVF3, HS-40, MARE, NPR3, RMD11
Disease Acronyms (UniProt) Disease acronyms from UniProt database
FFEVF3
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The function of the encoded protein is not known. [provided by RefSeq, Aug 2011]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs886037958 ->A Pathogenic Frameshift variant, coding sequence variant
rs886037959 CTGT>GGATGGGTCA Pathogenic Splice acceptor variant, intron variant
rs886037960 ->TG Pathogenic Frameshift variant, coding sequence variant
rs886037961 G>A,T Pathogenic Synonymous variant, stop gained, coding sequence variant
rs886037962 G>- Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT051275 hsa-miR-16-5p CLASH 23622248
MIRT039648 hsa-miR-615-3p CLASH 23622248
MIRT639720 hsa-miR-501-5p HITS-CLIP 23824327
MIRT639719 hsa-miR-1248 HITS-CLIP 23824327
MIRT639718 hsa-miR-4778-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003281 Process Ventricular septum development IEA
GO:0005096 Function GTPase activator activity IDA 23723238
GO:0005515 Function Protein binding IPI 19521502, 28199315, 28514442
GO:0005765 Component Lysosomal membrane IDA 28199306
GO:0032007 Process Negative regulation of TOR signaling IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600928 14124 ENSG00000103148
Protein
UniProt ID Q12980
Protein name GATOR1 complex protein NPRL3 (-14 gene protein) (Alpha-globin regulatory element-containing gene protein) (Nitrogen permease regulator 3-like protein) (Protein CGTHBA)
Protein function As a component of the GATOR1 complex functions as an inhibitor of the amino acid-sensing branch of the mTORC1 pathway (PubMed:23723238, PubMed:29590090, PubMed:35338845). In response to amino acid depletion, the GATOR1 complex has GTPase activat
PDB 6CES , 6CET , 7T3A , 7T3B , 7T3C , 8FW5
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03666 NPR3 63 112 Nitrogen Permease regulator of amino acid transport activity 3 Family
PF03666 NPR3 101 418 Nitrogen Permease regulator of amino acid transport activity 3 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in the frontal lobe cortex as well as in the temporal, parietal, and occipital lobes (PubMed:26505888, PubMed:27173016). {ECO:0000269|PubMed:26505888, ECO:0000269|PubMed:27173016}.
Sequence
MRDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTSKPRSRYAASNTGDHADEQDG
DSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQISKTDPSPKREAPT
MILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAM
ADGNEGPQSPFHHILPKCKLARDLKEAYDSLCTSGVVRLHINSWLEVSFCLPHKIHYAAS
SLIPPEAIERSLKAIRPYHALLLLSDEKSLLGELPIDCSPALVRVIKTTSAVKNLQQLAQ
DADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNASVCLYSPLAEQFSHQFPSHD
LPSVLAKFSLPVSLSEFRNPLAPAVQETQLIQMVVWMLQRRLLIQLHTYVCLMASPSE
EE
PRPREDDVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPSGDSPLNQ
RMTENLLASLSEHERAAILSVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRSQL
LMLFDKFRSVLVVTTHEDPVIAVFQALLP
Sequence length 569
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  mTOR signaling pathway   Amino acids regulate mTORC1
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Anemia, Sickle Cell rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
23406172
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
17463246
Epilepsy Epilepsy, Partial, with Variable Foci, EPILEPSY, FAMILIAL FOCAL, WITH VARIABLE FOCI 3, Familial focal epilepsy with variable foci rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670
View all (165 more)
26505888, 27173016, 26285051
Unknown
Disease term Disease name Evidence References Source
Pulmonary Fibrosis Pulmonary Fibrosis GWAS
Associations from Text Mining
Disease Name Relationship Type References
alpha Thalassemia Associate 10910890, 32720864
Anemia Associate 32720864
Anemia Hypochromic Associate 32720864
Anemia hypochromic microcytic Associate 32720864
Anemia Sickle Cell Associate 23406172, 29590102
Cerulean cataract Associate 23406172
Cortical Dysplasia Focal Epilepsy Syndrome Associate 26786403
Drug Resistant Epilepsy Associate 37099548
Endometrial Neoplasms Associate 34970268
Epilepsies Partial Associate 36639812