Gene Gene information from NCBI Gene database.
Entrez ID 813
Gene name Calumenin
Gene symbol CALU
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q32.1
Summary The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include ret
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs339097 A>G Drug-response Intron variant
miRNA miRNA information provided by mirtarbase database.
1027
miRTarBase ID miRNA Experiments Reference
MIRT019978 hsa-miR-375 Microarray 20215506
MIRT021030 hsa-miR-155-5p Proteomics 18668040
MIRT021863 hsa-miR-132-3p Microarray 17612493
MIRT023190 hsa-miR-124-3p Microarray 18668037
MIRT023336 hsa-miR-122-5p Proteomics 21750653
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 10094503
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding TAS 9218460
GO:0005515 Function Protein binding IPI 18688696, 22768251, 25416956, 32814053, 36217030
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603420 1458 ENSG00000128595
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43852
Protein name Calumenin (Crocalbin) (IEF SSP 9302)
Protein function Involved in regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. Seems to inhibit gamma-carboxylase GGCX. Binds 7 calcium ions with a low affinity (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 265 294 EF-hand domain pair Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at high levels in heart, placenta and skeletal muscle, at lower levels in lung, kidney and pancreas and at very low levels in brain and liver.
Sequence
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT
FDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNE
DGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEF
RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
Sequence length 315
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Developmental disorder Likely pathogenic rs2536275504 RCV003128071
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 14630798
Barrett Esophagus Associate 33491460
Carcinoma Hepatocellular Associate 37960718
Colonic Diseases Associate 32469983
Colorectal Neoplasms Associate 18776587, 32422974
Cystic Fibrosis Associate 25120007
Endometrial Neoplasms Associate 21305022
Glioma Associate 39533401
Inflammation Associate 37443777
Lung Neoplasms Associate 32469983