Gene Gene information from NCBI Gene database.
Entrez ID 8125
Gene name Acidic nuclear phosphoprotein 32 family member A
Gene symbol ANP32A
Synonyms (NCBI Gene)
C15orf1HPPCnI1PP2ALANPMAPMPHAP1PHAPIPP32
Chromosome 15
Chromosome location 15q23
miRNA miRNA information provided by mirtarbase database.
250
miRTarBase ID miRNA Experiments Reference
MIRT006515 hsa-miR-21-5p Luciferase reporter assayqRT-PCRWestern blot 21317927
MIRT006515 hsa-miR-21-5p Luciferase reporter assayqRT-PCRWestern blot 21317927
MIRT006515 hsa-miR-21-5p Luciferase reporter assayqRT-PCRWestern blot 21317927
MIRT006515 hsa-miR-21-5p Luciferase reporter assayqRT-PCRWestern blot 21317927
MIRT023840 hsa-miR-1-3p Proteomics 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 16169070, 17557114, 21806989, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 11555662, 11729309
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600832 13233 ENSG00000140350
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P39687
Protein name Acidic leucine-rich nuclear phosphoprotein 32 family member A (Acidic nuclear phosphoprotein pp32) (pp32) (Leucine-rich acidic nuclear protein) (LANP) (Mapmodulin) (Potent heat-stable protein phosphatase 2A inhibitor I1PP2A) (Putative HLA-DR-associated pr
Protein function Multifunctional protein that is involved in the regulation of many processes including tumor suppression, apoptosis, cell cycle progression or transcription (PubMed:10400610, PubMed:11360199, PubMed:16341127, PubMed:18439902). Promotes apoptosis
PDB 2JE0 , 2JE1 , 4XOS , 6XZQ , 8RMR , 8RN0 , 8RNA , 8RNB , 8RNC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14580 LRR_9 33 166 Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate
Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL
PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL
FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEG
LDDEEEDEDEEEYD
EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE
PEDEGEDDD
Sequence length 249
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    HuR (ELAVL1) binds and stabilizes mRNA
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Familial cancer of breast Benign rs181780074 RCV005903149
Uterine corpus endometrial carcinoma Benign rs181780074 RCV005903150
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Retroviral Syndrome Associate 31444273
Adenocarcinoma Associate 14695340
Alzheimer Disease Associate 35283023
Breast Neoplasms Associate 17567741, 17906614, 36140725
Carcinoma Hepatocellular Associate 20066738
Carcinoma Hepatocellular Stimulate 35280441
Carcinoma Pancreatic Ductal Inhibit 17906614
Cognition Disorders Associate 35283023
Cognitive Dysfunction Associate 35283023
Diabetes Mellitus Type 1 Associate 36477008