TCL1A (TCL1 family AKT coactivator A)

Gene

• Entrez ID: 8115
• Gene name: TCL1 family AKT coactivator A
• Gene symbol: TCL1A
• Synonyms (NCBI Gene): TCL1
• Chromosome: 14
• Chromosome location: 14q32.13
• Summary: Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004510	hsa-miR-29b-3p	Luciferase reporter assay	17707831
MIRT004510	hsa-miR-29b-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	17178851
MIRT005106	hsa-miR-181b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	17178851
MIRT005106	hsa-miR-181b-5p	Western blot	17178851
MIRT004510	hsa-miR-29b-3p	Western blot	17178851
MIRT1416611	hsa-miR-1207-5p	CLIP-seq
MIRT1416612	hsa-miR-3189-3p	CLIP-seq
MIRT1416613	hsa-miR-4433	CLIP-seq
MIRT1416614	hsa-miR-4473	CLIP-seq
MIRT1416615	hsa-miR-4536	CLIP-seq
MIRT1416616	hsa-miR-4722-5p	CLIP-seq
MIRT1416617	hsa-miR-4736	CLIP-seq
MIRT1416618	hsa-miR-4763-3p	CLIP-seq
MIRT1416619	hsa-miR-512-3p	CLIP-seq
MIRT1416620	hsa-miR-520f	CLIP-seq
MIRT2347364	hsa-miR-1912	CLIP-seq
MIRT2347365	hsa-miR-3138	CLIP-seq
MIRT2347366	hsa-miR-3619-3p	CLIP-seq
MIRT2347367	hsa-miR-4251	CLIP-seq
MIRT2347368	hsa-miR-4491	CLIP-seq
MIRT2347369	hsa-miR-4657	CLIP-seq
MIRT2347370	hsa-miR-4764-5p	CLIP-seq
MIRT2347371	hsa-miR-4776-5p	CLIP-seq
MIRT2347372	hsa-miR-4800-5p	CLIP-seq
MIRT2347373	hsa-miR-539	CLIP-seq
MIRT2395594	hsa-miR-1205	CLIP-seq
MIRT2395595	hsa-miR-4417	CLIP-seq
MIRT2395596	hsa-miR-4438	CLIP-seq
MIRT2395597	hsa-miR-4514	CLIP-seq
MIRT2395598	hsa-miR-4692	CLIP-seq
MIRT1416617	hsa-miR-4736	CLIP-seq
MIRT2395599	hsa-miR-5095	CLIP-seq
MIRT2395600	hsa-miR-548v	CLIP-seq
MIRT2395601	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16934922, 19064921, 21516116, 25416956, 25910212, 26871637, 27107012, 29997244, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA
GO:0019901	Function	Protein kinase binding	IPI	10983986
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	10983986
GO:0042802	Function	Identical protein binding	IDA	10983986
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	10983986
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IMP	10983986

Other IDs

• MIM: 186960
• HGNC: 11648
• e!Ensembl: ENSG00000100721

Protein

• UniProt ID: P56279
• Protein name: T-cell leukemia/lymphoma protein 1A (Oncogene TCL-1) (Oncogene TCL1) (Protein p14 TCL1)
• Protein function: Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. {ECO:0000269|PubMed:10716693, ECO:00
• PDB: 1JSG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01840	TCL1_MTCP1	1 → 112	TCL1/MTCP1 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.
• Sequence:

  MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR
  PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

• Sequence length: 114

Pathways

KEGG:

PI3K-Akt signaling pathway

<