Gene Gene information from NCBI Gene database.
Entrez ID 8106
Gene name Poly(A) binding protein nuclear 1
Gene symbol PABPN1
Synonyms (NCBI Gene)
OPMDPAB2PABIIPABP-2PABP2
Chromosome 14
Chromosome location 14q11.2
Summary This gene encodes an abundant nuclear protein that binds with high affinity to nascent poly(A) tails. The protein is required for progressive and efficient polymerization of poly(A) tails at the 3` ends of eukaryotic transcripts and controls the size of t
miRNA miRNA information provided by mirtarbase database.
287
miRTarBase ID miRNA Experiments Reference
MIRT049653 hsa-miR-92a-3p CLASH 23622248
MIRT040712 hsa-miR-92b-3p CLASH 23622248
MIRT040418 hsa-miR-615-3p CLASH 23622248
MIRT622940 hsa-miR-670-3p HITS-CLIP 23824327
MIRT622945 hsa-miR-5571-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade ISS
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
GO:0003723 Function RNA binding TAS 9462747
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602279 8565 ENSG00000100836
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86U42
Protein name Polyadenylate-binding protein 2 (PABP-2) (Poly(A)-binding protein 2) (Nuclear poly(A)-binding protein 1) (Poly(A)-binding protein II) (PABII) (Polyadenylate-binding nuclear protein 1)
Protein function Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product (By similarity). Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail e
PDB 3B4D , 3B4M , 3UCG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 174 243 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEEL
LLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEEEPGLVEGDPGDGAIEDPELE
AIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVD
YGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIK
VIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARAT
SWYSPY
Sequence length 306
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  mRNA surveillance pathway
Influenza A
  Inhibition of Host mRNA Processing and RNA Silencing
mRNA Splicing - Major Pathway
mRNA 3'-end processing
RNA Polymerase II Transcription Termination
Processing of Intronless Pre-mRNAs
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
32
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Oculopharyngeal muscular dystrophy Likely pathogenic; Pathogenic rs193922941, rs1594987281 RCV000851331
RCV001784791
RCV000989181
Oculopharyngeal muscular dystrophy 1 Likely pathogenic; Pathogenic rs193922941, rs1337792814, rs1888252890 RCV004017579
RCV005006045
RCV004576882
RCV005630404
RCV005630270
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
PABPN1-related disorder Benign; Uncertain significance; Conflicting classifications of pathogenicity; Likely benign rs2295126, rs188436762, rs104894466, rs947151586, rs150924353 RCV003975889
RCV003917599
RCV003934808
RCV003954054
RCV003939666
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alternating hemiplegia of childhood Associate 32929364
Breast Neoplasms Associate 32929364
Carcinogenesis Associate 32929364
Carcinoma Non Small Cell Lung Inhibit 24975429
Deglutition Disorders Associate 24310666
Drug Related Side Effects and Adverse Reactions Associate 16101680
Hepatoblastoma Associate 37478905
Mitochondrial Diseases Associate 27854203
Movement Disorders Associate 33077830
Muscle Weakness Associate 24310666, 24449978, 27854203, 36847015