CLPTM1L (CLPTM1 like)

Gene

• Entrez ID: 81037
• Gene name: CLPTM1 like
• Gene symbol: CLPTM1L
• Synonyms (NCBI Gene): CRR9
• Chromosome: 5
• Chromosome location: 5p15.33
• Summary: The protein encoded by this gene is a membrane protein whose overexpression in cisplatin-sensitive cells causes apoptosis. Polymorphisms in this gene have been reported to increase susceptibility to several cancers, including lung, pancreatic, and breast

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT050451	hsa-miR-22-3p	CLASH	23622248
MIRT723526	hsa-miR-4694-3p	HITS-CLIP	19536157
MIRT723527	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT723525	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT723524	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT723523	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT723522	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT723521	hsa-miR-5093	HITS-CLIP	19536157
MIRT723526	hsa-miR-4694-3p	HITS-CLIP	19536157
MIRT723527	hsa-miR-6856-3p	HITS-CLIP	19536157
MIRT723525	hsa-miR-3688-3p	HITS-CLIP	19536157
MIRT723524	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT723523	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT723522	hsa-miR-203a-3p	HITS-CLIP	19536157
MIRT723521	hsa-miR-5093	HITS-CLIP	19536157
MIRT897732	hsa-miR-1271	CLIP-seq
MIRT897733	hsa-miR-1290	CLIP-seq
MIRT897734	hsa-miR-182	CLIP-seq
MIRT897735	hsa-miR-4452	CLIP-seq
MIRT897736	hsa-miR-4671-5p	CLIP-seq
MIRT897737	hsa-miR-96	CLIP-seq
MIRT1966207	hsa-miR-105	CLIP-seq
MIRT897732	hsa-miR-1271	CLIP-seq
MIRT897733	hsa-miR-1290	CLIP-seq
MIRT897734	hsa-miR-182	CLIP-seq
MIRT1966208	hsa-miR-2115	CLIP-seq
MIRT1966209	hsa-miR-3689a-3p	CLIP-seq
MIRT1966210	hsa-miR-3689c	CLIP-seq
MIRT1966211	hsa-miR-377	CLIP-seq
MIRT1966212	hsa-miR-4251	CLIP-seq
MIRT1966213	hsa-miR-4267	CLIP-seq
MIRT1966214	hsa-miR-4329	CLIP-seq
MIRT1966215	hsa-miR-4447	CLIP-seq
MIRT1966216	hsa-miR-4472	CLIP-seq
MIRT1966217	hsa-miR-4488	CLIP-seq
MIRT897736	hsa-miR-4671-5p	CLIP-seq
MIRT1966218	hsa-miR-4677-3p	CLIP-seq
MIRT1966219	hsa-miR-4679	CLIP-seq
MIRT1966220	hsa-miR-4691-5p	CLIP-seq
MIRT1966221	hsa-miR-4697-5p	CLIP-seq
MIRT1966222	hsa-miR-516a-3p	CLIP-seq
MIRT1966223	hsa-miR-518e	CLIP-seq
MIRT1966224	hsa-miR-539	CLIP-seq
MIRT1966225	hsa-miR-634	CLIP-seq
MIRT1966226	hsa-miR-654-3p	CLIP-seq
MIRT897737	hsa-miR-96	CLIP-seq
MIRT1966207	hsa-miR-105	CLIP-seq
MIRT2202010	hsa-miR-1292	CLIP-seq
MIRT1966208	hsa-miR-2115	CLIP-seq
MIRT1966209	hsa-miR-3689a-3p	CLIP-seq
MIRT1966210	hsa-miR-3689c	CLIP-seq
MIRT2202011	hsa-miR-4471	CLIP-seq
MIRT1966220	hsa-miR-4691-5p	CLIP-seq
MIRT1966222	hsa-miR-516a-3p	CLIP-seq
MIRT1966224	hsa-miR-539	CLIP-seq
MIRT1966226	hsa-miR-654-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0006915	Process	Apoptotic process	IEA
GO:0012505	Component	Endomembrane system	IBA	21873635
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA	21873635
GO:0016021	Component	Integral component of membrane	IEA

Other IDs

• MIM: 612585
• HGNC: 24308
• e!Ensembl: ENSG00000049656

Protein

• UniProt ID: Q96KA5
• Protein name: Lipid scramblase CLPTM1L (Cisplatin resistance-related protein 9) (CRR9p) (Cleft lip and palate transmembrane protein 1-like protein) (CLPTM1-like protein)
• Protein function: Scramblase that mediates the translocation of glucosaminylphosphatidylinositol (alpha-D-GlcN-(1-6)-(1,2-diacyl-sn-glycero-3-phospho)-1D-myo-inositol, GlcN-PI) across the endoplasmic reticulum (ER) membrane, from the cytosolic leaflet to the lumi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05602	CLPTM1	9 → 422	Cleft lip and palate transmembrane protein 1 (CLPTM1)	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:35344438}.
• Sequence:

  MWSGRSSFTSLVVGVFVVYVVHTCWVMYGIVYTRPCSGDANCIQPYLARRPKLQLSVYTT
  TRSHLGAENNIDLVLNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHD
  GKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMA
  DNFVFDGSSLPADVHRYMKMIQLGKTVHYLPILFIDQLSNRVKDLMVINRSTTELPLTVS
  YDKVSLGRLRFWIHMQDAVYSLQQFGFSEKDADEVKGIFVDTNLYFLALTFFVAAFHLLF
  DFLAFKNDISFWKKKKSMIGMSTKAVLWRCFSTVVIFLFLLDEQTSLLVLVPAGVGAAIE
  LWKVKKALKMTIFWRGLMPEFQFGTYSESERKTEEYDTQAMKYLSYLLYPLCVGGAVYSL
  LNIKYKSWYSWLINSFVNGVYAFGFLFMLPQLFVNYKLKSVAHLPWKAFTYKAFNTFIDD
  VFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVDKRRVNEFGESYEEKATRAPHTD

• Sequence length: 538

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Basal cell neoplasm	Basal Cell Neoplasm, Basal Cell Cancer	rs587776578, rs587776579, rs2117956624, rs2118419579, rs2118365442, rs2118041703, rs2136689212, rs2118336503, rs1587692888, rs267606984, rs878853849, rs1554695110, rs1064793921, rs1588605348, rs1588568813	25855136, 24403052, 27539887, 31174203, 19151717
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158, rs80357524, rs80357115, rs80357945, rs80357729, rs80357609, rs80357259, rs80357981, rs80358063, rs80357389, rs80356862, rs80359876, rs80357580, rs80358053, rs80358089, rs80187739, rs397507241, rs80358069, rs80357590, rs80357284, rs80357941, rs80359261, rs80359272, rs80359276, rs276174813, rs80358474, rs80359316, rs1555282969, rs80359388, rs80359499, rs80359505, rs80359520, rs80359526, rs80359533, rs56253082, rs80358824, rs80359554, rs80359636, rs80359651, rs80359659, rs80359011, rs80359012, rs80359013, rs80359718, rs397507410, rs81002812, rs80359730, rs80359152, rs80359159, rs397507419, rs28897759, rs80359211, rs80359775, rs397514577, rs397507584, rs80358435, rs80358456, rs80359340, rs80359343, rs80359365, rs80358579, rs397507670, rs80358593, rs80359406, rs80359444, rs80359454, rs276174853, rs276174854, rs80359483, rs80359537, rs80358815, rs80358843, rs80359558, rs80359560, rs80359594, rs80358893, rs28897743, rs397507900, rs397507906, rs397507918, rs80358971, rs80358981, rs397507941, rs80359030, rs80359035, rs41293511, rs397507396, rs81002806, rs80359112, rs397508006, rs81002893, rs45580035, rs80359760, rs397508051, rs80359772, rs4987049, rs80359777, rs80357770, rs397508867, rs62625303, rs397508874, rs80357506, rs80357287, rs273898674, rs80358042, rs80358083, rs80357058, rs41286296, rs80357960, rs80356945, rs80357223, rs386134270, rs80358116, rs80357856, rs80357424, rs397509050, rs80357485, rs80357966, rs397509067, rs80357310, rs80356866, rs80357260, rs80357437, rs80358023, rs80358086, rs80357133, rs80356993, rs80357997, rs80357239, rs80357227, rs397509243, rs80356969, rs80356959, rs63750617, rs63751319, rs587779315, rs200640585, rs398122546, rs80357543, rs398122687, rs80359328, rs398122779, rs398122783, rs62517194, rs80358029, rs515726060, rs180177103, rs180177111, rs180177133, rs587776527, rs180177135, rs180177136, rs515726117, rs587779813, rs587779909, rs587780024, rs587780100, rs28909982, rs121908698, rs180177100, rs587780210, rs587780240, rs587780639, rs587781269, rs587781353, rs587781471, rs587781658, rs587781697, rs587781730, rs587781894, rs587781948, rs587782005, rs587782011, rs200928781, rs587781558, rs370228071, rs587782245, rs587782401, rs180177110, rs587782504, rs72552322, rs587782531, rs587782620, rs587782680, rs587782774, rs587782818, rs730881411, rs730881389, rs564652222, rs397507768, rs587776419, rs730881868, rs730881940, rs56383036, rs758972589, rs201089102, rs730881348, rs786202608, rs786201886, rs786203318, rs786203775, rs786203714, rs786202033, rs750621215, rs786203884, rs786203650, rs772821016, rs863224521, rs864622223, rs864622655, rs375699023, rs876659572, rs768362387, rs876659535, rs876658957, rs483353072, rs876659435, rs267608041, rs876661113, rs730881369, rs878853535, rs772228129, rs878855122, rs760551339, rs80359596, rs397509222, rs886039630, rs886039683, rs886040828, rs587781799, rs886040374, rs886040649, rs397507967, rs878854957, rs886040043, rs1057517589, rs1060502769, rs866380588, rs863224765, rs1064793243, rs747563556, rs1555074976, rs1064795885, rs753961188, rs1064794708, rs869312772, rs1064793887, rs1131690820, rs1135401928, rs1135401868, rs1135401859, rs1553370324, rs397507630, rs1555283160, rs1555283251, rs1555283262, rs1555283361, rs1555286298, rs1555288462, rs886040950, rs1555289566, rs776323117, rs80357123, rs1555579627, rs1555580697, rs80358054, rs1555593302, rs1328985852, rs763470424, rs1555139694, rs878854697, rs1555461217, rs1555461765, rs774684620, rs766416564, rs1554558613, rs1305740166, rs1555461460, rs1555461407, rs1555461586, rs1555567202, rs1555607022, rs1555069815, rs1442299125, rs1474786480, rs1555084947, rs1555457867, rs141087784, rs1482641121, rs1564830522, rs1565469955, rs1565503137, rs864622613, rs755263466, rs757679199, rs1593903166, rs1597801649, rs1603293306, rs879253880, rs80358754, rs1597062038, rs45494092, rs1603275367, rs887358871, rs1597091518, rs1966967065, rs1064793049, rs2082872908, rs2085078278, rs2072475243
Carcinoma	Basal cell carcinoma, Carcinoma, Basal Cell	rs121912654, rs555607708, rs786202962, rs1564055259	27539887, 25855136, 19151717, 31174203, 24403052
Cervical cancer	cervical cancer	rs28934571, rs121913482, rs121913483	19151717
Lung carcinoma	Non-Small Cell Lung Carcinoma, Squamous cell carcinoma of lung, Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355, rs121912470, rs121913273, rs121913281, rs121913348, rs727503093, rs121913353, rs397516890, rs397516896, rs121913378, rs397516897, rs397516977, rs397516978, rs397516979, rs397516980, rs397516981, rs397516982, rs121913240, rs17851045, rs397517086, rs121913428, rs397517094, rs397517098, rs397517106, rs121913465, rs397517108, rs397517111, rs397517112, rs397517114, rs397517116, rs1554350366, rs397517127, rs397517200, rs397517202, rs121913283, rs121913370, rs121913357, rs727503106, rs121913238, rs727503108, rs397517040, rs397516976, rs1555618025, rs1057519729, rs1584238193	22675468, 31326317, 28604730, 31009812, 18978787
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370, rs760043106, rs1057519788, rs1131692238, rs1131692237, rs1554350382	31326317, 31009812, 22675468, 19836008
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	19151717, 19654303, 24366883, 22899653, 18978787, 18978790
Melanoma	melanoma, Cutaneous Melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340, rs398123152, rs587780668, rs587782083, rs587782206, rs587782792, rs180177042, rs121913381, rs730881675, rs730881674, rs730881677, rs730881673, rs1800586, rs768966657, rs587778189, rs786204195, rs121913321, rs45476696, rs864622636, rs864622263, rs869025340, rs876660436, rs876658534, rs876658556, rs878853647, rs878853644, rs878853650, rs886041162, rs121913389, rs1057519852, rs121913384, rs121913387, rs1060501266, rs1060501263, rs1060501262, rs749714198, rs1060501265, rs559848002, rs1064794292, rs1131691187, rs1131691186, rs199907548, rs1554654052, rs1554656411, rs1554656624, rs1554653915, rs1554653956, rs1554656253, rs1554654224, rs754806883, rs1057520039, rs1563889584, rs1563889685, rs1287464120, rs1563888944, rs1563892715, rs1563889847, rs141798398, rs1587332338, rs1587340291, rs11552823, rs561034503, rs138677674, rs1819962958, rs1820531050	21983787, 30429480
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431	20101243
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19151717
Uveal melanoma	Uveal melanoma	rs1559588632	28781888

Unknown
Disease term	Disease name	Evidence	References	Source
Malignant melanoma of skin	Malignant melanoma of skin of lower limb, Malignant melanoma of skin of upper limb		30429480	ClinVar
Nasopharyngeal carcinoma	Nasopharyngeal carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.	20512145	ClinVar, CBGDA
Lymphocytic Leukemia	Lymphocytic Leukemia			GWAS
Uveal Melanoma	Uveal Melanoma	Furthermore, knocking-down GPS2 promoted the proliferation and metastatic abilities of UM cells both in vivo and in vitro.		GWAS, CBGDA
Nasopharyngeal Carcinoma	Nasopharyngeal Carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.		GWAS, CBGDA
Uterine Fibroids	Uterine Fibroids			GWAS
Diabetes	Diabetes			GWAS
Cervical Cancer	Cervical Cancer	Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2).		GWAS, CBGDA

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma	Associate	20700438, 23738012, 24386361, 27246533, 33393640
Adenocarcinoma of Lung	Associate	22370939, 23555636, 25233467, 28181565
Adenocarcinoma of Lung	Stimulate	22675468, 23300716
Basal Cell Nevus Syndrome	Associate	25159867
Breast Neoplasms	Associate	20056641, 22037553
Carcinogenesis	Associate	22412903, 22675468, 24386361, 25155038, 33213418, 38254939
Carcinoma Basal Cell	Associate	19578363, 25159867
Carcinoma Bronchogenic	Associate	21622582
Carcinoma Hepatocellular	Associate	25122662, 25339005
Carcinoma Non Small Cell Lung	Associate	22675468, 24039754, 24175795, 32943060, 33393640
Carcinoma Ovarian Epithelial	Associate	21949822
Carcinoma Squamous Cell	Associate	24386361
Carcinoma Squamous Cell	Inhibit	24386361
Cleft Lip	Associate	23395979
Cleft Palate	Associate	23395979
Colorectal Neoplasms	Associate	22351525, 22878375
Emphysema	Associate	21622582
Endometrial Neoplasms	Associate	25487306
Esophageal Neoplasms	Associate	25007268, 26304507
Esophageal Squamous Cell Carcinoma	Associate	25007268, 26716642
Gastrointestinal Neoplasms	Associate	26372813
Gastrointestinal Stromal Tumors	Associate	26372813
Intraocular Lymphoma	Associate	36459980
Leiomyosarcoma	Associate	22419440
Liver Cirrhosis Biliary	Associate	21622582
Lung Neoplasms	Associate	18978790, 19151717, 20056643, 20142248, 20548021, 20700438, 21622582, 21771723, 21966413, 22675468, 22945651, 23228068, 23300716, 23368278, 23433592, 23555636, 23738012, 24386361, 25155038, 25415319, 25526467, 25789475, 26138067, 26352532, 26852039, 31009812, 33393640
Lung Neoplasms	Stimulate	27062701
Melanoma	Associate	19578363, 21116649, 23393597, 24642353, 25789475, 25837821, 27993549, 31203567
Melanoma Cutaneous Malignant	Associate	19151717
Monosomy	Associate	34424336
Mouth Neoplasms	Associate	27749845
Nasopharyngeal Carcinoma	Associate	26621837, 31270100, 31289279
Nasopharyngeal Neoplasms	Associate	31270100
Neoplasms	Associate	19151717, 20101243, 20460502, 20543847, 20570912, 20802237, 21949822, 22878375, 22945651, 24386361, 25027329, 25122662, 25339005, 25487306, 26053551, 26621837, 26716642, 27749845, 30635792, 31203567, 34040254, 36459980, 38254939
Neoplasms	Stimulate	31009812
Neoplasms Germ Cell and Embryonal	Associate	21617256
Oropharyngeal Neoplasms	Inhibit	20802237
Oropharyngeal Neoplasms	Associate	20802237
Ovarian Neoplasms	Associate	22675468, 31009812
Pancreatic Neoplasms	Associate	20101243, 24022295, 24058443, 24577890, 24642353, 25940397, 27579533, 27797938, 28447668, 31203567, 31917448
Pancreatitis	Associate	28447668
Prostatic Neoplasms	Associate	22653581, 24651484, 26773531
Rectal Neoplasms	Associate	22351525
Skin Neoplasms	Associate	21116649
Small Cell Lung Carcinoma	Associate	25415319
Squamous Cell Carcinoma of Head and Neck	Associate	20802237, 28025427, 30635792, 32576588
Testicular Germ Cell Tumor	Associate	21617256
Thyroid Cancer Papillary	Associate	27185198
Tobacco Use Disorder	Associate	22945651, 25233467
Triple Negative Breast Neoplasms	Associate	22037553
Uniparental Disomy	Associate	34424336
Urinary Bladder Neoplasms	Associate	19151717, 21081471, 25347272, 33213418, 38254939
Uterine Cervical Neoplasms	Associate	33794208, 36929174
Uveal melanoma	Associate	34424336, 36459980