Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80746
Gene name Gene Name - the full gene name approved by the HGNC.
TRNA splicing endonuclease subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TSEN2
Synonyms (NCBI Gene) Gene synonyms aliases
PCH2B, SEN2, SEN2L
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PCH2B
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseu
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113981920 A>G Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance Non coding transcript variant, synonymous variant, coding sequence variant, genic downstream transcript variant, downstream transcript variant
rs113994149 A>G Pathogenic Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs146117200 G>A,C Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity Intron variant, missense variant, coding sequence variant, non coding transcript variant
rs730880294 C>T Pathogenic Stop gained, intron variant, coding sequence variant, non coding transcript variant
rs755246924 AG>- Likely-pathogenic Non coding transcript variant, coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT043908 hsa-miR-378a-3p CLASH 23622248
MIRT1458434 hsa-miR-3065-5p CLIP-seq
MIRT1458435 hsa-miR-1184 CLIP-seq
MIRT1458436 hsa-miR-1205 CLIP-seq
MIRT1458437 hsa-miR-1270 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000213 Function TRNA-intron endonuclease activity IBA 21873635
GO:0000214 Component TRNA-intron endonuclease complex IBA 21873635
GO:0000379 Process TRNA-type intron splice site recognition and cleavage IBA 21873635
GO:0003676 Function Nucleic acid binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608753 28422 ENSG00000154743
Protein
UniProt ID Q8NCE0
Protein name tRNA-splicing endonuclease subunit Sen2 (EC 4.6.1.16) (tRNA-intron endonuclease Sen2) (HsSen2)
Protein function Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intr
PDB 7UXA , 7ZRZ , 8HMY , 8HMZ , 8ISS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02778 tRNA_int_endo_N 265 329 tRNA intron endonuclease, N-terminal domain Domain
PF01974 tRNA_int_endo 339 431 tRNA intron endonuclease, catalytic C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform 1 and isoform 2 are widely expressed at very low level. {ECO:0000269|PubMed:15109492}.
Sequence
MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQL
YGKGYFGKGILSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQ
DESTVRRILKDYTKPLEHPPVKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKS
GGVGDPREPLGCLQEGSGCHPTTESFEKSVREDASPLPHVCCCKQDALILQRGLHHEDGS
QHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQRNRLICRRNPYRIFEYLQLS
LEEAFFLVYALGCLSIYYEKEPLTIVKLW
KAFTVVQPTFRTTYMAYHYFRSKGWVPKVGL
KYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML
CYLIKPSTMTD
KEMESPECMKRIKVQEVILSRWVSSRERSDQDDL
Sequence length 465
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    tRNA processing in the nucleus
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Mental retardation Profound Mental Retardation, Mental deficiency, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
18711368
Microcephaly Microcephaly rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019
View all (280 more)
18711368
Microlissencephaly Microlissencephaly rs771116788 18711368
Pontoneocerebellar hypoplasia Pontocerebellar Hypoplasia Type 2A, Pontocerebellar Hypoplasia Type 2B, Pontocerebellar Hypoplasia Type 2, Pontocerebellar hypoplasia type 2, Congenital pontocerebellar hypoplasia rs63749985, rs113994152, rs113994153, rs113994154, rs113994150, rs137853063, rs267607036, rs267607035, rs886037629, rs147391618, rs141138948, rs672601331, rs387907196, rs672601332, rs397515426
View all (108 more)
18711368, 20952379, 23562994
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Diabetes Mellitus Type 2 Associate 30956117
Pontocerebellar Hypoplasia Type 2 Associate 20803644
Young McKeever Squier syndrome Associate 20952379