Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80746
Gene name Gene Name - the full gene name approved by the HGNC.	TRNA splicing endonuclease subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TSEN2
Synonyms (NCBI Gene) Gene synonyms aliases	PCH2B, SEN2, SEN2L
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p25.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the subunits of the tRNA splicing endonuclease. This endonuclease catalyzes the first step in RNA splicing which is the removal of introns. Mutations in this gene have been associated with pontocerebellar hypoplasia type 2. A pseu

Show/Hide all(10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113981920	A>G	Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance	Non coding transcript variant, synonymous variant, coding sequence variant, genic downstream transcript variant, downstream transcript variant
rs113994149	A>G	Pathogenic	Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs146117200	G>A,C	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant, missense variant, coding sequence variant, non coding transcript variant
rs730880294	C>T	Pathogenic	Stop gained, intron variant, coding sequence variant, non coding transcript variant
rs755246924	AG>-	Likely-pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs797046051	A>G,T	Likely-pathogenic	Non coding transcript variant, downstream transcript variant, genic downstream transcript variant, missense variant, coding sequence variant
rs797046052	CAA>-	Likely-pathogenic	Inframe deletion, non coding transcript variant, coding sequence variant, genic upstream transcript variant
rs886037738	GTAAG>-	Pathogenic	Splice donor variant, intron variant, non coding transcript variant, coding sequence variant
rs886037739	G>A	Pathogenic	Missense variant, intron variant, non coding transcript variant, coding sequence variant
rs1477347690	A>G	Likely-pathogenic	Missense variant, intron variant, coding sequence variant, non coding transcript variant

Show/Hide all(103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043908	hsa-miR-378a-3p	CLASH	23622248
MIRT1458434	hsa-miR-3065-5p	CLIP-seq
MIRT1458435	hsa-miR-1184	CLIP-seq
MIRT1458436	hsa-miR-1205	CLIP-seq
MIRT1458437	hsa-miR-1270	CLIP-seq
MIRT1458438	hsa-miR-185	CLIP-seq
MIRT1458439	hsa-miR-1910	CLIP-seq
MIRT1458440	hsa-miR-3158-5p	CLIP-seq
MIRT1458441	hsa-miR-4306	CLIP-seq
MIRT1458442	hsa-miR-4531	CLIP-seq
MIRT1458443	hsa-miR-4644	CLIP-seq
MIRT1458444	hsa-miR-620	CLIP-seq
MIRT1458445	hsa-miR-877	CLIP-seq
MIRT1458446	hsa-miR-103a	CLIP-seq
MIRT1458447	hsa-miR-107	CLIP-seq
MIRT1458448	hsa-miR-1200	CLIP-seq
MIRT1458449	hsa-miR-15a	CLIP-seq
MIRT1458450	hsa-miR-15b	CLIP-seq
MIRT1458451	hsa-miR-16	CLIP-seq
MIRT1458452	hsa-miR-1912	CLIP-seq
MIRT1458453	hsa-miR-195	CLIP-seq
MIRT1458454	hsa-miR-224	CLIP-seq
MIRT1458455	hsa-miR-3074-5p	CLIP-seq
MIRT1458456	hsa-miR-3130-5p	CLIP-seq
MIRT1458457	hsa-miR-331-3p	CLIP-seq
MIRT1458458	hsa-miR-338-3p	CLIP-seq
MIRT1458459	hsa-miR-383	CLIP-seq
MIRT1458460	hsa-miR-3908	CLIP-seq
MIRT1458461	hsa-miR-424	CLIP-seq
MIRT1458462	hsa-miR-4275	CLIP-seq
MIRT1458463	hsa-miR-4292	CLIP-seq
MIRT1458464	hsa-miR-4324	CLIP-seq
MIRT1458465	hsa-miR-4482	CLIP-seq
MIRT1458466	hsa-miR-4524	CLIP-seq
MIRT1458467	hsa-miR-4528	CLIP-seq
MIRT1458468	hsa-miR-4530	CLIP-seq
MIRT1458469	hsa-miR-4646-5p	CLIP-seq
MIRT1458470	hsa-miR-4649-3p	CLIP-seq
MIRT1458471	hsa-miR-4677-3p	CLIP-seq
MIRT1458472	hsa-miR-4747-5p	CLIP-seq
MIRT1458473	hsa-miR-4762-5p	CLIP-seq
MIRT1458474	hsa-miR-497	CLIP-seq
MIRT1458475	hsa-miR-503	CLIP-seq
MIRT1458476	hsa-miR-544b	CLIP-seq
MIRT1458477	hsa-miR-561	CLIP-seq
MIRT1458478	hsa-miR-580	CLIP-seq
MIRT1458479	hsa-miR-646	CLIP-seq
MIRT1458480	hsa-miR-891a	CLIP-seq
MIRT1458435	hsa-miR-1184	CLIP-seq
MIRT1458436	hsa-miR-1205	CLIP-seq
MIRT1458439	hsa-miR-1910	CLIP-seq
MIRT2358419	hsa-miR-3123	CLIP-seq
MIRT2358420	hsa-miR-3126-5p	CLIP-seq
MIRT1458440	hsa-miR-3158-5p	CLIP-seq
MIRT2358421	hsa-miR-4419a	CLIP-seq
MIRT2358422	hsa-miR-4510	CLIP-seq
MIRT2358423	hsa-miR-568	CLIP-seq
MIRT2396402	hsa-miR-4279	CLIP-seq
MIRT2396403	hsa-miR-4287	CLIP-seq
MIRT2396404	hsa-miR-4685-3p	CLIP-seq
MIRT2396405	hsa-miR-4780	CLIP-seq
MIRT2396406	hsa-miR-581	CLIP-seq
MIRT2396407	hsa-miR-623	CLIP-seq
MIRT2462471	hsa-miR-4776-3p	CLIP-seq
MIRT2462472	hsa-miR-4795-3p	CLIP-seq
MIRT1458435	hsa-miR-1184	CLIP-seq
MIRT1458436	hsa-miR-1205	CLIP-seq
MIRT1458437	hsa-miR-1270	CLIP-seq
MIRT2651643	hsa-miR-1827	CLIP-seq
MIRT1458438	hsa-miR-185	CLIP-seq
MIRT1458439	hsa-miR-1910	CLIP-seq
MIRT2651644	hsa-miR-2467-5p	CLIP-seq
MIRT1458440	hsa-miR-3158-5p	CLIP-seq
MIRT2396402	hsa-miR-4279	CLIP-seq
MIRT1458441	hsa-miR-4306	CLIP-seq
MIRT2651645	hsa-miR-4459	CLIP-seq
MIRT1458442	hsa-miR-4531	CLIP-seq
MIRT1458443	hsa-miR-4644	CLIP-seq
MIRT2651646	hsa-miR-4695-5p	CLIP-seq
MIRT2651647	hsa-miR-4722-5p	CLIP-seq
MIRT2651648	hsa-miR-4782-5p	CLIP-seq
MIRT1458444	hsa-miR-620	CLIP-seq
MIRT2651649	hsa-miR-760	CLIP-seq
MIRT1458445	hsa-miR-877	CLIP-seq
MIRT2651650	hsa-miR-940	CLIP-seq
MIRT1458435	hsa-miR-1184	CLIP-seq
MIRT1458436	hsa-miR-1205	CLIP-seq
MIRT1458437	hsa-miR-1270	CLIP-seq
MIRT2651643	hsa-miR-1827	CLIP-seq
MIRT1458438	hsa-miR-185	CLIP-seq
MIRT2651644	hsa-miR-2467-5p	CLIP-seq
MIRT1458440	hsa-miR-3158-5p	CLIP-seq
MIRT1458441	hsa-miR-4306	CLIP-seq
MIRT2651645	hsa-miR-4459	CLIP-seq
MIRT1458442	hsa-miR-4531	CLIP-seq
MIRT1458443	hsa-miR-4644	CLIP-seq
MIRT2651646	hsa-miR-4695-5p	CLIP-seq
MIRT2651647	hsa-miR-4722-5p	CLIP-seq
MIRT2651648	hsa-miR-4782-5p	CLIP-seq
MIRT1458444	hsa-miR-620	CLIP-seq
MIRT2651649	hsa-miR-760	CLIP-seq
MIRT1458445	hsa-miR-877	CLIP-seq
MIRT2651650	hsa-miR-940	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000213	Function	TRNA-intron lyase activity	IBA
GO:0000213	Function	TRNA-intron lyase activity	IEA
GO:0000214	Component	TRNA-intron endonuclease complex	IBA
GO:0000214	Component	TRNA-intron endonuclease complex	IEA
GO:0000379	Process	TRNA-type intron splice site recognition and cleavage	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006388	Process	TRNA splicing, via endonucleolytic cleavage and ligation	IDA	17495927
GO:0006388	Process	TRNA splicing, via endonucleolytic cleavage and ligation	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008033	Process	TRNA processing	IBA
GO:0008033	Process	TRNA processing	IEA
GO:0016829	Function	Lyase activity	IEA

MIM	HGNC	e!Ensembl
608753	28422	ENSG00000154743

Protein

UniProt ID

Q8NCE0

Protein name

tRNA-splicing endonuclease subunit Sen2 (EC 4.6.1.16) (tRNA-intron endonuclease Sen2) (HsSen2)

Protein function

Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intr

PDB

7UXA , 7ZRZ , 8HMY , 8HMZ , 8ISS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02778	tRNA_int_endo_N	265 → 329	tRNA intron endonuclease, N-terminal domain	Domain
PF01974	tRNA_int_endo	339 → 431	tRNA intron endonuclease, catalytic C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are widely expressed at very low level. {ECO:0000269|PubMed:15109492}.

Sequence

MAEAVFHAPKRKRRVYETYESPLPIPFGQDHGPLKEFKIFRAEMINNNVIVRNAEDIEQL
YGKGYFGKGILSRSRPSFTISDPKLVAKWKDMKTNMPIITSKRYQHSVEWAAELMRRQGQ
DESTVRRILKDYTKPLEHPPVKRNEEAQVHDKLNSGMVSNMEGTAGGERPSVVNGDSGKS
GGVGDPREPLGCLQEGSGCHPTTESFEKSVREDASPLPHVCCCKQDALILQRGLHHEDGS
QHIGLLHPGDRGPDHEYVLVEEAECAMSEREAAPNEELVQRNRLICRRNPYRIFEYLQLS
LEEAFFLVYALGCLSIYYEKEPLTIVKLWKAFTVVQPTFRTTYMAYHYFRSKGWVPKVGL
KYGTDLLLYRKGPPFYHASYSVIIELVDDHFEGSLRRPLSWKSLAALSRVSVNVSKELML
CYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL

Sequence length

465

Interactions

View interactions

	Reactome
			tRNA processing in the nucleus

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Pontoneocerebellar hypoplasia	pontoneocerebellar hypoplasia, pontocerebellar hypoplasia type 2b	rs755246924, rs1477347690, rs201467485, rs886037738, rs886037739, rs730880294, rs797046052, rs797046051	N/A

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes, Type 2 diabetes mellitus or coronary artery disease (pleiotropy), Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy)	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Periodontal Diseases	Periodontal disease	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Diabetes Mellitus Type 2	Associate	30956117
Pontocerebellar Hypoplasia Type 2	Associate	20803644
Young McKeever Squier syndrome	Associate	20952379

TSEN2 (tRNA splicing endonuclease subunit 2)