Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80381
Gene name Gene Name - the full gene name approved by the HGNC.	CD276 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD276
Synonyms (NCBI Gene) Gene synonyms aliases	4Ig-B7-H3, B7-H3, B7H3, B7RP-2
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q24.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues an

Show/Hide all(243)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003343	hsa-miR-29a-3p	Review	20026422
MIRT004631	hsa-miR-29c-3p	Review	20026422
MIRT003343	hsa-miR-29a-3p	Luciferase reporter assay, Western blot	19584290
MIRT003343	hsa-miR-29a-3p	Luciferase reporter assay, Western blot	19584290
MIRT018004	hsa-miR-335-5p	Microarray	18185580
MIRT052388	hsa-let-7a-5p	CLASH	23622248
MIRT050009	hsa-miR-28-5p	CLASH	23622248
MIRT049416	hsa-miR-92a-3p	CLASH	23622248
MIRT039444	hsa-miR-421	CLASH	23622248
MIRT036011	hsa-miR-1301-3p	CLASH	23622248
MIRT052669	hsa-miR-1260b	CLASH	23622248
MIRT004631	hsa-miR-29c-3p	Microarray, qRT-PCR	24590289
MIRT438714	hsa-miR-187-3p	Luciferase reporter assay, qRT-PCR	23916610
MIRT438714	hsa-miR-187-3p	Luciferase reporter assay, qRT-PCR	23916610
MIRT003343	hsa-miR-29a-3p	PAR-CLIP	26701625
MIRT004631	hsa-miR-29c-3p	PAR-CLIP	26701625
MIRT734596	hsa-miR-2909	Luciferase reporter assay, Western blotting	33676551
MIRT874453	hsa-let-7a	CLIP-seq
MIRT874454	hsa-let-7b	CLIP-seq
MIRT874455	hsa-let-7c	CLIP-seq
MIRT874456	hsa-let-7d	CLIP-seq
MIRT874457	hsa-let-7e	CLIP-seq
MIRT874458	hsa-let-7f	CLIP-seq
MIRT874459	hsa-let-7g	CLIP-seq
MIRT874460	hsa-let-7i	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874462	hsa-miR-1294	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874464	hsa-miR-202	CLIP-seq
MIRT874465	hsa-miR-2392	CLIP-seq
MIRT874466	hsa-miR-2467-3p	CLIP-seq
MIRT874467	hsa-miR-3150a-3p	CLIP-seq
MIRT874468	hsa-miR-3158-5p	CLIP-seq
MIRT874469	hsa-miR-3175	CLIP-seq
MIRT874470	hsa-miR-3184	CLIP-seq
MIRT874471	hsa-miR-3605-5p	CLIP-seq
MIRT874472	hsa-miR-3678-3p	CLIP-seq
MIRT874473	hsa-miR-423-5p	CLIP-seq
MIRT874474	hsa-miR-4418	CLIP-seq
MIRT874475	hsa-miR-4458	CLIP-seq
MIRT874476	hsa-miR-4500	CLIP-seq
MIRT874477	hsa-miR-4505	CLIP-seq
MIRT874478	hsa-miR-4640-5p	CLIP-seq
MIRT874479	hsa-miR-4688	CLIP-seq
MIRT874480	hsa-miR-4695-5p	CLIP-seq
MIRT874481	hsa-miR-4710	CLIP-seq
MIRT874482	hsa-miR-4726-5p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874484	hsa-miR-485-5p	CLIP-seq
MIRT874485	hsa-miR-491-5p	CLIP-seq
MIRT874486	hsa-miR-509-3-5p	CLIP-seq
MIRT874487	hsa-miR-509-5p	CLIP-seq
MIRT874488	hsa-miR-625	CLIP-seq
MIRT874489	hsa-miR-665	CLIP-seq
MIRT874490	hsa-miR-671-5p	CLIP-seq
MIRT874491	hsa-miR-939	CLIP-seq
MIRT874492	hsa-miR-98	CLIP-seq
MIRT874453	hsa-let-7a	CLIP-seq
MIRT874454	hsa-let-7b	CLIP-seq
MIRT874455	hsa-let-7c	CLIP-seq
MIRT874456	hsa-let-7d	CLIP-seq
MIRT874457	hsa-let-7e	CLIP-seq
MIRT874458	hsa-let-7f	CLIP-seq
MIRT874459	hsa-let-7g	CLIP-seq
MIRT874460	hsa-let-7i	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874493	hsa-miR-124	CLIP-seq
MIRT874494	hsa-miR-1253	CLIP-seq
MIRT874495	hsa-miR-1267	CLIP-seq
MIRT874496	hsa-miR-1270	CLIP-seq
MIRT874497	hsa-miR-1275	CLIP-seq
MIRT874498	hsa-miR-128	CLIP-seq
MIRT874499	hsa-miR-1293	CLIP-seq
MIRT874462	hsa-miR-1294	CLIP-seq
MIRT874500	hsa-miR-1321	CLIP-seq
MIRT874501	hsa-miR-148a	CLIP-seq
MIRT874502	hsa-miR-148b	CLIP-seq
MIRT874503	hsa-miR-152	CLIP-seq
MIRT874504	hsa-miR-187	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874505	hsa-miR-1913	CLIP-seq
MIRT874506	hsa-miR-1915	CLIP-seq
MIRT874464	hsa-miR-202	CLIP-seq
MIRT874507	hsa-miR-214	CLIP-seq
MIRT874508	hsa-miR-2278	CLIP-seq
MIRT874509	hsa-miR-27a	CLIP-seq
MIRT874510	hsa-miR-27b	CLIP-seq
MIRT874511	hsa-miR-296-5p	CLIP-seq
MIRT874512	hsa-miR-29a	CLIP-seq
MIRT874513	hsa-miR-29b	CLIP-seq
MIRT874514	hsa-miR-29c	CLIP-seq
MIRT874515	hsa-miR-3120-5p	CLIP-seq
MIRT874516	hsa-miR-3147	CLIP-seq
MIRT874517	hsa-miR-3173-3p	CLIP-seq
MIRT874518	hsa-miR-3185	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874520	hsa-miR-3190	CLIP-seq
MIRT874521	hsa-miR-324-3p	CLIP-seq
MIRT874522	hsa-miR-339-5p	CLIP-seq
MIRT874523	hsa-miR-34c-3p	CLIP-seq
MIRT874524	hsa-miR-3545-5p	CLIP-seq
MIRT874525	hsa-miR-361-3p	CLIP-seq
MIRT874526	hsa-miR-3614-5p	CLIP-seq
MIRT874527	hsa-miR-3619-5p	CLIP-seq
MIRT874528	hsa-miR-3657	CLIP-seq
MIRT874529	hsa-miR-3665	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT874531	hsa-miR-3910	CLIP-seq
MIRT874532	hsa-miR-3922-5p	CLIP-seq
MIRT874533	hsa-miR-4251	CLIP-seq
MIRT874534	hsa-miR-4260	CLIP-seq
MIRT874535	hsa-miR-4270	CLIP-seq
MIRT874536	hsa-miR-4284	CLIP-seq
MIRT874537	hsa-miR-4302	CLIP-seq
MIRT874538	hsa-miR-4318	CLIP-seq
MIRT874539	hsa-miR-4329	CLIP-seq
MIRT874540	hsa-miR-4421	CLIP-seq
MIRT874541	hsa-miR-4425	CLIP-seq
MIRT874542	hsa-miR-4434	CLIP-seq
MIRT874543	hsa-miR-4437	CLIP-seq
MIRT874544	hsa-miR-4441	CLIP-seq
MIRT874545	hsa-miR-4446-3p	CLIP-seq
MIRT874475	hsa-miR-4458	CLIP-seq
MIRT874546	hsa-miR-4476	CLIP-seq
MIRT874547	hsa-miR-4477a	CLIP-seq
MIRT874548	hsa-miR-4483	CLIP-seq
MIRT874549	hsa-miR-4488	CLIP-seq
MIRT874476	hsa-miR-4500	CLIP-seq
MIRT874550	hsa-miR-4516	CLIP-seq
MIRT874551	hsa-miR-451b	CLIP-seq
MIRT874552	hsa-miR-4527	CLIP-seq
MIRT874553	hsa-miR-4531	CLIP-seq
MIRT874554	hsa-miR-4533	CLIP-seq
MIRT874555	hsa-miR-4656	CLIP-seq
MIRT874556	hsa-miR-4665-5p	CLIP-seq
MIRT874557	hsa-miR-4668-5p	CLIP-seq
MIRT874558	hsa-miR-4669	CLIP-seq
MIRT874559	hsa-miR-4693-5p	CLIP-seq
MIRT874560	hsa-miR-4697-3p	CLIP-seq
MIRT874561	hsa-miR-4697-5p	CLIP-seq
MIRT874481	hsa-miR-4710	CLIP-seq
MIRT874562	hsa-miR-4711-3p	CLIP-seq
MIRT874563	hsa-miR-4711-5p	CLIP-seq
MIRT874564	hsa-miR-4728-5p	CLIP-seq
MIRT874565	hsa-miR-4739	CLIP-seq
MIRT874566	hsa-miR-4753-5p	CLIP-seq
MIRT874567	hsa-miR-4756-5p	CLIP-seq
MIRT874568	hsa-miR-4758-3p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874569	hsa-miR-4779	CLIP-seq
MIRT874570	hsa-miR-4790-3p	CLIP-seq
MIRT874571	hsa-miR-506	CLIP-seq
MIRT874572	hsa-miR-511	CLIP-seq
MIRT874573	hsa-miR-539	CLIP-seq
MIRT874574	hsa-miR-541	CLIP-seq
MIRT874575	hsa-miR-548an	CLIP-seq
MIRT874576	hsa-miR-583	CLIP-seq
MIRT874577	hsa-miR-586	CLIP-seq
MIRT874578	hsa-miR-620	CLIP-seq
MIRT874579	hsa-miR-657	CLIP-seq
MIRT874489	hsa-miR-665	CLIP-seq
MIRT874490	hsa-miR-671-5p	CLIP-seq
MIRT874580	hsa-miR-7	CLIP-seq
MIRT874581	hsa-miR-761	CLIP-seq
MIRT874582	hsa-miR-892a	CLIP-seq
MIRT874583	hsa-miR-9	CLIP-seq
MIRT874584	hsa-miR-940	CLIP-seq
MIRT874492	hsa-miR-98	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874493	hsa-miR-124	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT874531	hsa-miR-3910	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874571	hsa-miR-506	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874498	hsa-miR-128	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874535	hsa-miR-4270	CLIP-seq
MIRT874544	hsa-miR-4441	CLIP-seq
MIRT1959278	hsa-miR-4514	CLIP-seq
MIRT1959279	hsa-miR-4645-5p	CLIP-seq
MIRT1959280	hsa-miR-4673	CLIP-seq
MIRT1959281	hsa-miR-4692	CLIP-seq
MIRT1959282	hsa-miR-4703-3p	CLIP-seq
MIRT1959283	hsa-miR-4755-3p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874584	hsa-miR-940	CLIP-seq
MIRT2196309	hsa-miR-1179	CLIP-seq
MIRT2196310	hsa-miR-188-3p	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT2196311	hsa-miR-4422	CLIP-seq
MIRT874461	hsa-miR-1207-5p	CLIP-seq
MIRT874499	hsa-miR-1293	CLIP-seq
MIRT874463	hsa-miR-1909	CLIP-seq
MIRT874505	hsa-miR-1913	CLIP-seq
MIRT874507	hsa-miR-214	CLIP-seq
MIRT874518	hsa-miR-3185	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874520	hsa-miR-3190	CLIP-seq
MIRT874521	hsa-miR-324-3p	CLIP-seq
MIRT874523	hsa-miR-34c-3p	CLIP-seq
MIRT874527	hsa-miR-3619-5p	CLIP-seq
MIRT874529	hsa-miR-3665	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT874545	hsa-miR-4446-3p	CLIP-seq
MIRT874548	hsa-miR-4483	CLIP-seq
MIRT874555	hsa-miR-4656	CLIP-seq
MIRT874568	hsa-miR-4758-3p	CLIP-seq
MIRT874483	hsa-miR-4763-3p	CLIP-seq
MIRT874575	hsa-miR-548an	CLIP-seq
MIRT874579	hsa-miR-657	CLIP-seq
MIRT874490	hsa-miR-671-5p	CLIP-seq
MIRT874580	hsa-miR-7	CLIP-seq
MIRT874581	hsa-miR-761	CLIP-seq
MIRT874499	hsa-miR-1293	CLIP-seq
MIRT874518	hsa-miR-3185	CLIP-seq
MIRT874548	hsa-miR-4483	CLIP-seq
MIRT874580	hsa-miR-7	CLIP-seq
MIRT2499329	hsa-miR-1178	CLIP-seq
MIRT874494	hsa-miR-1253	CLIP-seq
MIRT874506	hsa-miR-1915	CLIP-seq
MIRT874466	hsa-miR-2467-3p	CLIP-seq
MIRT874511	hsa-miR-296-5p	CLIP-seq
MIRT2499330	hsa-miR-3126-5p	CLIP-seq
MIRT2499331	hsa-miR-3137	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874525	hsa-miR-361-3p	CLIP-seq
MIRT874530	hsa-miR-3714	CLIP-seq
MIRT2499332	hsa-miR-3913-3p	CLIP-seq
MIRT1959282	hsa-miR-4703-3p	CLIP-seq
MIRT874570	hsa-miR-4790-3p	CLIP-seq
MIRT2499333	hsa-miR-489	CLIP-seq
MIRT874576	hsa-miR-583	CLIP-seq
MIRT2499329	hsa-miR-1178	CLIP-seq
MIRT874506	hsa-miR-1915	CLIP-seq
MIRT874511	hsa-miR-296-5p	CLIP-seq
MIRT2499331	hsa-miR-3137	CLIP-seq
MIRT874519	hsa-miR-3189-5p	CLIP-seq
MIRT874525	hsa-miR-361-3p	CLIP-seq
MIRT2499332	hsa-miR-3913-3p	CLIP-seq
MIRT1959282	hsa-miR-4703-3p	CLIP-seq
MIRT874570	hsa-miR-4790-3p	CLIP-seq
MIRT2499333	hsa-miR-489	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	NAS	11224528
GO:0005515	Function	Protein binding	IPI	18650384
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	NAS	15188059
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	15188059
GO:0032649	Process	Regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IDA	11224528
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	11224528
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042110	Process	T cell activation	IDA	18650384
GO:0042110	Process	T cell activation	IEA
GO:0050776	Process	Regulation of immune response	NAS	11224528
GO:0050852	Process	T cell receptor signaling pathway	IBA

MIM	HGNC	e!Ensembl
605715	19137	ENSG00000103855

Protein

UniProt ID

Q5ZPR3

Protein name

CD276 antigen (4Ig-B7-H3) (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD antigen CD276)

Protein function

May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	32 → 138	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	144 → 224		Domain
PF07686	V-set	250 → 356	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	362 → 442		Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous but not detectable in peripheral blood lymphocytes or granulocytes. Weakly expressed in resting monocytes. Expressed in dendritic cells derived from monocytes. Expressed in epithelial cells of sinonasal tissue. Expressed in

Sequence

MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSL
AQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSF
TCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQD
GQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQ
RSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEG
RDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPY
SKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLF
DVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIAL
LVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA

Sequence length

534

Interactions

View interactions

	KEGG
	Cell adhesion molecules

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Dyslexia	Dyslexia	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Long QT Syndrome	long qt syndrome	N/A	N/A	ClinVar
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Tourette Syndrome	Tourette syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (134)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	30808776
Abortion Habitual	Inhibit	37685876
Acute erythroleukemia	Stimulate	26376842
Acute erythroleukemia	Associate	34562306
Adenocarcinoma	Associate	17686830
Adenocarcinoma of Lung	Associate	26851185, 33426073, 34419075, 35590371, 38177255
Adenoma	Associate	16489649
Adenomyosis	Associate	34289871
Adrenocortical Carcinoma	Associate	31998416, 34194394
Aicardi Syndrome	Associate	31998416
Allergic Fungal Sinusitis	Associate	15961727
Angiomyolipoma	Associate	19501877
Arthritis Rheumatoid	Associate	17323353, 26702052
Asthma	Stimulate	30075787
Brain Neoplasms	Inhibit	35443752
Brain Neoplasms	Associate	35876221, 37528722
Breast Neoplasms	Associate	24562936, 24577056, 28537889, 31292534, 32602545, 33782032, 33932112, 34018684, 34265738, 36423363, 36901916, 37643511, 37648771, 39367484, 39735676, 40393975 View all (1 more)
Breast Neoplasms	Stimulate	24892449, 35384874
Calcinosis Cutis	Associate	27801901, 35940046
Carcinogenesis	Associate	29924389, 30813210, 35920698, 37974070
Carcinoma Hepatocellular	Associate	22729558, 24194851, 30942404, 32544882, 34104078, 34603293, 37861541
Carcinoma Intraductal Noninfiltrating	Associate	34588590
Carcinoma Merkel Cell	Associate	30808776
Carcinoma Non Small Cell Lung	Stimulate	21597388
Carcinoma Non Small Cell Lung	Associate	25609202, 26149216, 26823710, 26851185, 27960166, 28539467, 35029291, 35443752, 35920698, 38124403
Carcinoma Ovarian Epithelial	Associate	31892360
Carcinoma Pancreatic Ductal	Stimulate	20976171
Carcinoma Pancreatic Ductal	Associate	35862858, 38364961
Carcinoma Renal Cell	Associate	18694993, 24885059, 25089268, 32166404, 32322590, 34081621, 36894965, 39614178, 39621555, 40428825
Carcinoma Squamous Cell	Associate	29484464, 32322590, 38182561
Cardiac Output Low	Associate	33795387
Cell Transformation Neoplastic	Stimulate	33301369
Chordoma	Associate	35145510
Colonic Neoplasms	Associate	23098490
Colorectal Neoplasms	Associate	20333377, 23098490, 25139714, 25684945, 26787540, 30131660, 32363121, 32514163, 32719950, 33011740, 37661645
Colorectal Neoplasms	Stimulate	24892449, 31424670
Communicable Diseases	Associate	29423417
Craniopharyngioma	Associate	32958683, 37870091
Death	Associate	18694993, 19276267
Desmoplastic Small Round Cell Tumor	Associate	18613926, 32703985
Diabetes Mellitus Type 1	Associate	32787907
Diffuse Intrinsic Pontine Glioma	Associate	23232807
Drug Hypersensitivity	Associate	30075787
Drug Related Side Effects and Adverse Reactions	Associate	35514986
Endometrial Neoplasms	Associate	35804040, 37159818
Esophageal Neoplasms	Associate	27764786
Esophageal Squamous Cell Carcinoma	Associate	35752862
Fibrolamellar hepatocellular carcinoma	Associate	30902819
Gallbladder Neoplasms	Associate	27874953, 36159808
GATA2 Deficiency	Associate	33889438
Glioblastoma	Associate	24892449, 31075138, 34168003, 34565408, 36474171, 36717836, 37770968
Glioma	Stimulate	30027617
Glioma of Brain Familial	Associate	30027617
Glycosuria Renal	Associate	19501877
Head and Neck Neoplasms	Associate	35140722
Hepatitis B	Associate	31044564, 32602545
Hereditary Breast and Ovarian Cancer Syndrome	Associate	39735676
HIV Infections	Associate	37430239
Hypopharyngeal Neoplasms	Associate	35941227
Hypothyroidism Congenital Nongoitrous 2	Associate	34289871
Hypoxia	Stimulate	36093941
Hypoxia	Associate	36685583
Idiopathic Pulmonary Fibrosis	Stimulate	38203769
Immune System Diseases	Associate	37070487
Inflammation	Associate	17323353, 26702052
Inflammation	Stimulate	31412888
Kartagener Syndrome	Associate	15961727
Kidney Neoplasms	Associate	39621555
Leukemia	Associate	36361619
Leukemia Lymphocytic Chronic B Cell	Associate	22547582
Leukemia Myeloid Acute	Associate	25130683, 26376842, 34562306, 34787059, 36361619, 37070487
Liver Failure	Associate	31044564
Lung Neoplasms	Associate	27960166, 28539467, 32633367, 35443752, 38124403
Lymphangioleiomyomatosis	Associate	19501877, 36869048
Lymphatic Metastasis	Stimulate	25609202, 34417325
Lymphatic Metastasis	Associate	32633367, 36525343, 39621555
Lymphoma	Associate	37870091
Medulloblastoma	Associate	18613926, 32145124, 32992699, 34988920, 35876221, 36825029, 40269882
Melanoma	Associate	23474948, 33925968, 35940046
Melanoma Cutaneous Malignant	Associate	23474948
Meningioma	Stimulate	36203966
Mental Retardation X Linked 92	Associate	36361619
Methylcobalamin Deficiency CblG Type	Associate	38182561
Mixed Tumor Malignant	Associate	38124403
Mouth Diseases	Associate	34289871
Mouth Neoplasms	Associate	26438868
Myelodysplastic Syndromes	Associate	33730109
Myositis	Stimulate	18975328
Neoplasm Invasiveness	Associate	36685583
Neoplasm Metastasis	Associate	19276267, 23474948, 23940627, 24577056, 27801901, 30942404, 31424670, 35029291, 39621555, 40269882
Neoplasms	Associate	18694993, 19276267, 19584290, 20035626, 20333377, 20495537, 21251161, 21597388, 22729558, 23232807, 23474948, 23497351, 23940627, 24562936, 24577056 View all (61 more)
Neoplasms	Inhibit	23098490, 32145124, 34265738
Neoplasms	Stimulate	30813210, 34417325, 34680929
Neuroblastoma	Associate	18613926, 23232807, 24069378, 28866709, 33795387, 35852863, 37130627
Neuroendocrine Tumors	Associate	30670493, 35671167
Oropharyngeal Neoplasms	Associate	35941227
Osteosarcoma	Associate	23940627, 27644254, 31950059, 35312779, 36320072, 36519392
Ovarian Diseases	Associate	31892360
Ovarian Neoplasms	Associate	20495537, 34290311, 37800814
Pancreatic Neoplasms	Associate	20035626, 35219310, 35624419, 37974070
Pemphigus	Associate	18373702
Personality Disorders	Associate	32514163
Phyllodes Tumor	Associate	30486739
Pleural Effusion Malignant	Associate	32633367
Pneumonia	Associate	31088519, 35836993
Pneumonia	Stimulate	35836993
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	35514986
Prodromal Symptoms	Associate	25139714
Prostatic Neoplasms	Associate	17686830, 18042703, 18829542, 19276267, 27801901, 32581061, 34417325, 35333400, 36114082, 36245088, 36481650, 37452083, 37967200, 40615466
Prostatic Neoplasms Castration Resistant	Associate	37452083, 37967200, 40615466
Pyruvate Carboxylase Deficiency Disease	Associate	36114082
Retinoblastoma	Associate	32576886
Rhabdomyosarcoma	Associate	18975328
Rhabdomyosarcoma Alveolar	Associate	34552155
Sarcoma	Associate	36275693
Sick Sinus Syndrome	Associate	36983005
Sjogren's Syndrome	Associate	31412888
Small Cell Lung Carcinoma	Associate	30850021
Squamous Cell Carcinoma of Head and Neck	Associate	26438868, 31089395, 32548602, 32959211, 35115487, 35941227, 36268020, 38096229
Squamous Cell Carcinoma of Head and Neck	Stimulate	34675936, 36983005
Stomach Neoplasms	Associate	16489649, 21251161, 32025206, 33669921, 34459388, 37488673
Stomach Neoplasms	Stimulate	30813210
T cell immunodeficiency primary	Associate	37070487
Tertiary Lymphoid Structures	Inhibit	35941227
Thyroid cancer medullary	Associate	34680929
Thyroid cancer medullary	Stimulate	37373167
Thyroid Cancer Papillary	Associate	35574031, 36120433, 36525343
Thyroid Neoplasms	Associate	35574031
Triple Negative Breast Neoplasms	Associate	35384874
Tuberous Sclerosis	Associate	36869048
Urethral Neoplasms	Associate	33845814, 35563359, 35751046
Urinary Bladder Neoplasms	Associate	33306717, 33845814, 35563359, 35751046, 36175880
Uterine Cervical Diseases	Associate	32322590
Uterine Cervical Neoplasms	Associate	29924389, 34848831, 35942212

CD276 (CD276 molecule)