PDCD1LG2 (programmed cell death 1 ligand 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80380
Gene name Gene Name - the full gene name approved by the HGNC.
Programmed cell death 1 ligand 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDCD1LG2
Synonyms (NCBI Gene) Gene synonyms aliases
B7DC, Btdc, CD273, PD-L2, PDCD1L2, PDL2, bA574F11.2
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p24.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(82)
miRTarBase ID miRNA Experiments Reference
MIRT1219241 hsa-miR-106a CLIP-seq
MIRT1219242 hsa-miR-106b CLIP-seq
MIRT1219243 hsa-miR-142-5p CLIP-seq
MIRT1219244 hsa-miR-17 CLIP-seq
MIRT1219245 hsa-miR-186 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(19)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 20587542, 23417675, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605723 18731 ENSG00000197646
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9BQ51
Protein name Programmed cell death 1 ligand 2 (PD-1 ligand 2) (PD-L2) (PDCD1 ligand 2) (Programmed death ligand 2) (Butyrophilin B7-DC) (B7-DC) (CD antigen CD273)
Protein function Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By simil
PDB 6UMT , 8J3V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13927 Ig_3 22 → 105 Domain
PF08205 C2-set_2 125 → 202 CD80-like C2-set immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus. {ECO:0000269|PubMed:11224527}.
Sequence 
MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ
KVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK
ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL
RLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATV
IALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
Sequence length 273
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell adhesion molecules   PD-1 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)		 26830138
Show/Hide Text Mining Associations (144)
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 30783096
Acute On Chronic Liver Failure Associate 36505417
Addison Disease Associate 37807083
Adenocarcinoma Associate 27775076, 32468013, 36445478, 37970475
Adenocarcinoma of Lung Associate 26851185, 30348714, 31159869, 31163080, 31294893, 34419075, 35149175, 36688087, 37131252, 37790851
Adenomyosis Associate 34289871
Adrenocortical Carcinoma Associate 34194394
Allergic Fungal Sinusitis Associate 15961727
Aortic Aneurysm Abdominal Associate 37055467
Arthralgia Associate 29489833