PDCD1LG2 (programmed cell death 1 ligand 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 80380
Gene name Programmed cell death 1 ligand 2
Gene symbol PDCD1LG2
Synonyms (NCBI Gene)
B7DCBtdcCD273PD-L2PDCD1L2PDL2bA574F11.2
Chromosome 9
Chromosome location 9p24.1
miRNA miRNA information provided by mirtarbase database.
82
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (82)
miRTarBase ID miRNA Experiments Reference
MIRT1219241 hsa-miR-106a CLIP-seq
MIRT1219242 hsa-miR-106b CLIP-seq
MIRT1219243 hsa-miR-142-5p CLIP-seq
MIRT1219244 hsa-miR-17 CLIP-seq
MIRT1219245 hsa-miR-186 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 20587542, 23417675, 32296183
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605723 18731 ENSG00000197646
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BQ51
Protein name Programmed cell death 1 ligand 2 (PD-1 ligand 2) (PD-L2) (PDCD1 ligand 2) (Programmed death ligand 2) (Butyrophilin B7-DC) (B7-DC) (CD antigen CD273)
Protein function Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By simil
PDB 6UMT , 8J3V
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13927 Ig_3 22 → 105 Domain
PF08205 C2-set_2 125 → 202 CD80-like C2-set immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus. {ECO:0000269|PubMed:11224527}.
Sequence 
MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ
KVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK
ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL
RLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATV
IALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
Sequence length 273
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Cell adhesion molecules   PD-1 signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (144)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 30783096
★★★★★
★☆☆☆☆
Found in Text Mining only
Acute On Chronic Liver Failure Associate 36505417
★★★★★
★☆☆☆☆
Found in Text Mining only
Addison Disease Associate 37807083
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Associate 27775076, 32468013, 36445478, 37970475
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of Lung Associate 26851185, 30348714, 31159869, 31163080, 31294893, 34419075, 35149175, 36688087, 37131252, 37790851
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenomyosis Associate 34289871
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenocortical Carcinoma Associate 34194394
★★★★★
★☆☆☆☆
Found in Text Mining only
Allergic Fungal Sinusitis Associate 15961727
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm Abdominal Associate 37055467
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthralgia Associate 29489833
★★★★★
★☆☆☆☆
Found in Text Mining only