Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80320
Gene name Gene Name - the full gene name approved by the HGNC.
Sp6 transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SP6
Synonyms (NCBI Gene) Gene synonyms aliases
AI1K, EPFN, EPIPROFIN, KLF14
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequenc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1381549 hsa-miR-1 CLIP-seq
MIRT1381550 hsa-miR-1207-5p CLIP-seq
MIRT1381551 hsa-miR-1236 CLIP-seq
MIRT1381552 hsa-miR-1294 CLIP-seq
MIRT1381553 hsa-miR-1827 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001837 Process Epithelial to mesenchymal transition IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608613 14530 ENSG00000189120
Protein
UniProt ID Q3SY56
Protein name Transcription factor Sp6 (Krueppel-like factor 14)
Protein function Promotes cell proliferation (By similarity). Plays a role in tooth germ growth (By similarity). Plays a role in the control of enamel mineralization. Binds the AMBN promoter (PubMed:32167558). {ECO:0000250|UniProtKB:Q9ESX2, ECO:0000269|PubMed:32
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 254 278 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 284 308 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 314 336 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPE
VDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSW
WDLHPGTSWMDLPHTQGALTSPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQ
HLLGPPDGAKALEVAAPESQGLDSSLDGAARPKGSRRSVPRSSGQTVCRCPNCLEAERLG
APCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDE
LQRHLQTH
TGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGEGKAGGAVEPP
GGKGKREAEGSVAPSN
Sequence length 376
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Amelogenesis imperfecta amelogenesis imperfecta, IIa 1K N/A N/A GenCC
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 28480579
Amelogenesis Imperfecta Associate 32167558, 33652941
Amelogenesis imperfecta local hypoplastic form Associate 32167558, 33652941
Calcinosis Cutis Associate 23199169
Cognition Disorders Associate 28480579
Disease Associate 32167558
Personality Disorders Associate 34012061
Prostatic Neoplasms Associate 34012061
Schizophrenia Associate 28480579