Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80306
Gene name Gene Name - the full gene name approved by the HGNC.
Mediator complex subunit 28
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MED28
Synonyms (NCBI Gene) Gene synonyms aliases
1500003D12Rik, EG1, magicin
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.32
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002554 hsa-miR-373-3p Microarray 15685193
MIRT052202 hsa-let-7b-5p CLASH 23622248
MIRT047827 hsa-miR-30d-5p CLASH 23622248
MIRT038176 hsa-miR-423-5p CLASH 23622248
MIRT037505 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 10656681, 15175163, 15467741, 16763564, 16899217, 16964398, 21516116, 23455924, 24882805, 24981860, 25416956, 32296183, 32814053
GO:0005654 Component Nucleoplasm IDA
GO:0016020 Component Membrane IEA
GO:0016592 Component Mediator complex IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610311 24628 ENSG00000118579
Protein
UniProt ID Q9H204
Protein name Mediator of RNA polymerase II transcription subunit 28 (Endothelial-derived protein 1) (Mediator complex subunit 28) (Merlin and Grb2-interacting cytoskeletal protein) (Magicin) (Tumor angiogenesis marker EG-1)
Protein function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN
PDB 7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11594 Med28 43 143 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in vascular tissues such as placenta, testis and liver. {ECO:0000269|PubMed:15467741}.
Sequence
MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLV
SQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRN
ELQRKDALVQKHLTKLRHWQQVL
EDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
Sequence length 178
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    PPARA activates gene expression
Transcriptional regulation of white adipocyte differentiation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
21942447
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
21942447
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
21942447
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Stimulate 20584319
Carcinoma Ductal Breast Stimulate 20584319
Carcinoma Intraductal Noninfiltrating Stimulate 20584319
Carcinoma Non Small Cell Lung Associate 32196603
Colorectal Neoplasms Associate 36072467
Death Associate 20584319
Lung Neoplasms Associate 32196603
Neoplasms Associate 20584319
Status Asthmaticus Associate 9577517