MED28 (mediator complex subunit 28)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 80306
Gene name Mediator complex subunit 28
Gene symbol MED28
Synonyms (NCBI Gene)
1500003D12RikEG1magicin
Chromosome 4
Chromosome location 4p15.32
miRNA miRNA information provided by mirtarbase database.
1738
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1738)
miRTarBase ID miRNA Experiments Reference
MIRT002554 hsa-miR-373-3p Microarray 15685193
MIRT052202 hsa-let-7b-5p CLASH 23622248
MIRT047827 hsa-miR-30d-5p CLASH 23622248
MIRT038176 hsa-miR-423-5p CLASH 23622248
MIRT037505 hsa-miR-744-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (17)
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0005515 Function Protein binding IPI 10656681, 15175163, 15467741, 16763564, 16899217, 16964398, 21516116, 23455924, 24882805, 24981860, 25416956, 32296183, 32814053, 33961781, 35271311
GO:0005634 Component Nucleus IDA 24882805
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
610311 24628 ENSG00000118579
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H204
Protein name Mediator of RNA polymerase II transcription subunit 28 (Endothelial-derived protein 1) (Mediator complex subunit 28) (Merlin and Grb2-interacting cytoskeletal protein) (Magicin) (Tumor angiogenesis marker EG-1)
Protein function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN
PDB 7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8T9D , 8TQW , 8TRH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11594 Med28 43 → 143 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in vascular tissues such as placenta, testis and liver. {ECO:0000269|PubMed:15467741}.
Sequence 
MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLV
SQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRN
ELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT
Sequence length 178
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    PPARA activates gene expression
Transcriptional regulation of white adipocyte differentiation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hereditary breast ovarian cancer syndrome Uncertain significance rs1467250189 RCV001374525
Show/Hide Text Mining Associations (9)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Stimulate 20584319
Carcinoma Ductal Breast Stimulate 20584319
Carcinoma Intraductal Noninfiltrating Stimulate 20584319
Carcinoma Non Small Cell Lung Associate 32196603
Colorectal Neoplasms Associate 36072467
Death Associate 20584319
Lung Neoplasms Associate 32196603
Neoplasms Associate 20584319
Status Asthmaticus Associate 9577517