Gene Gene information from NCBI Gene database.
Entrez ID 80303
Gene name EF-hand domain family member D1
Gene symbol EFHD1
Synonyms (NCBI Gene)
MST133MSTP133PP3051SWS2
Chromosome 2
Chromosome location 2q37.1
Summary This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is compose
miRNA miRNA information provided by mirtarbase database.
243
miRTarBase ID miRNA Experiments Reference
MIRT016332 hsa-miR-193b-3p Microarray 20304954
MIRT953849 hsa-miR-2110 CLIP-seq
MIRT953850 hsa-miR-3126-3p CLIP-seq
MIRT953851 hsa-miR-3160-3p CLIP-seq
MIRT953852 hsa-miR-3176 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 33961781, 34819669
GO:0005739 Component Mitochondrion IEA
GO:0005739 Component Mitochondrion TAS 26975899
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611617 29556 ENSG00000115468
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BUP0
Protein name EF-hand domain-containing protein D1 (EF-hand domain-containing protein 1) (Swiprosin-2)
Protein function Acts as a calcium sensor for mitochondrial flash (mitoflash) activation, an event characterized by stochastic bursts of superoxide production (PubMed:26975899). May play a role in neuronal differentiation (By similarity). {ECO:0000250|UniProtKB:
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 92 156 EF-hand domain pair Domain
Sequence
MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLS
RRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMME
KLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFH
KAAAGELQEDSGLMALAKLSEIDV
ALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNT
Sequence length 239
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Anophthalmia-microphthalmia syndrome Likely benign rs370357320 RCV000207392
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 40441253
Carcinoma Renal Cell Associate 36747492
Colorectal Neoplasms Associate 24861485
Neoplasm Metastasis Inhibit 36747492