Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
80303
Gene name Gene Name - the full gene name approved by the HGNC.
EF-hand domain family member D1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EFHD1
Synonyms (NCBI Gene) Gene synonyms aliases
MST133, MSTP133, PP3051, SWS2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q37.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the EF-hand super family of calcium binding proteins, which are involved in a variety of cellular processes including mitosis, synaptic transmission, and cytoskeletal rearrangement. The protein encoded by this gene is compose
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016332 hsa-miR-193b-3p Microarray 20304954
MIRT953849 hsa-miR-2110 CLIP-seq
MIRT953850 hsa-miR-3126-3p CLIP-seq
MIRT953851 hsa-miR-3160-3p CLIP-seq
MIRT953852 hsa-miR-3176 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 33961781, 34819669
GO:0005739 Component Mitochondrion IEA
GO:0005739 Component Mitochondrion TAS 26975899
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611617 29556 ENSG00000115468
Protein
UniProt ID Q9BUP0
Protein name EF-hand domain-containing protein D1 (EF-hand domain-containing protein 1) (Swiprosin-2)
Protein function Acts as a calcium sensor for mitochondrial flash (mitoflash) activation, an event characterized by stochastic bursts of superoxide production (PubMed:26975899). May play a role in neuronal differentiation (By similarity). {ECO:0000250|UniProtKB:
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13499 EF-hand_7 92 156 EF-hand domain pair Domain
Sequence
MASEELACKLERRLRREEAEESGPQLAPLGAPAPEPKPEPEPPARAPTASADAELSAQLS
RRLDINEGAARPRRCRVFNPYTEFPEFSRRLIKDLESMFKLYDAGRDGFIDLMELKLMME
KLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFH
KAAAGELQEDSGLMALAKLSEIDV
ALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFNT
Sequence length 239
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Anophthalmia/Microphthalmia-Esophageal Atresia Syndrome Anophthalmia-microphthalmia syndrome N/A N/A ClinVar
Coronary artery disease Coronary artery disease N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 40441253
Carcinoma Renal Cell Associate 36747492
Colorectal Neoplasms Associate 24861485
Neoplasm Metastasis Inhibit 36747492