Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	80279
Gene name Gene Name - the full gene name approved by the HGNC.	CDK5 regulatory subunit associated protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CDK5RAP3
Synonyms (NCBI Gene) Gene synonyms aliases	C53, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114, PP1553
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001561	hsa-miR-155-5p	pSILAC	18668040
MIRT001561	hsa-miR-155-5p	Proteomics;Other	20584899
MIRT881334	hsa-miR-4794	CLIP-seq
MIRT2197794	hsa-miR-140-3p	CLIP-seq
MIRT2197795	hsa-miR-197	CLIP-seq
MIRT2197796	hsa-miR-3123	CLIP-seq
MIRT2197797	hsa-miR-3674	CLIP-seq
MIRT2197798	hsa-miR-3925-5p	CLIP-seq
MIRT2197799	hsa-miR-4705	CLIP-seq
MIRT2197800	hsa-miR-4732-5p	CLIP-seq
MIRT2197801	hsa-miR-578	CLIP-seq
MIRT2197802	hsa-miR-643	CLIP-seq

Show/Hide all(67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	ISS
GO:0001889	Process	Liver development	IEA
GO:0001889	Process	Liver development	ISS
GO:0001933	Process	Negative regulation of protein phosphorylation	IMP	17785205
GO:0005515	Function	Protein binding	IPI	16169070, 16173922, 17785205, 20164180, 20228063, 25416956, 25910212, 31515488, 32296183, 33961781, 37595036
GO:0005634	Component	Nucleus	IDA	16173922
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA	16173922
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	15790566, 16173922, 19223857, 20531390
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	36543799, 38383785, 38383789
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005813	Component	Centrosome	IDA	19223857
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	23478299
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	15790566
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0007420	Process	Brain development	NAS	10915792
GO:0008015	Process	Blood circulation	TAS	1400360
GO:0008283	Process	Cell population proliferation	IDA	12054757
GO:0010921	Process	Regulation of phosphatase activity	IMP	21283629
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	19223857
GO:0019901	Function	Protein kinase binding	NAS	10721722
GO:0030262	Process	Apoptotic nuclear changes	IMP	23478299
GO:0030332	Function	Cyclin binding	IPI	15790566
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IMP	23152784
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	16173922
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	17785205, 20228063
GO:0032790	Process	Ribosome disassembly	IDA	36517592
GO:0032790	Process	Ribosome disassembly	IDA	38383785, 38383789
GO:0032991	Component	Protein-containing complex	IDA	20531390
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	ISS
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	16173922
GO:0043407	Process	Negative regulation of MAP kinase activity	IMP	21283629
GO:0044387	Process	Negative regulation of protein kinase activity by regulation of protein phosphorylation	IMP	21283629
GO:0044389	Function	Ubiquitin-like protein ligase binding	IDA	20531390
GO:0044389	Function	Ubiquitin-like protein ligase binding	IEA
GO:0044818	Process	Mitotic G2/M transition checkpoint	IMP	19223857
GO:0045664	Process	Regulation of neuron differentiation	NAS	10721722
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	21283629
GO:0051059	Function	NF-kappaB binding	IPI	17785205
GO:0060318	Process	Definitive erythrocyte differentiation	IEA
GO:0060318	Process	Definitive erythrocyte differentiation	ISS
GO:0071569	Process	Protein ufmylation	IDA	23152784
GO:0071569	Process	Protein ufmylation	IDA	36121123, 36543799, 37595036, 38383785, 38383789
GO:0071569	Process	Protein ufmylation	IEA
GO:0071569	Process	Protein ufmylation	IMP	30635284
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	IMP	19223857
GO:0072344	Process	Rescue of stalled ribosome	IDA	37595036, 38383785, 38383789
GO:0072344	Process	Rescue of stalled ribosome	IMP	32851973
GO:0097371	Function	MDM2/MDM4 family protein binding	IPI	16173922
GO:0140501	Process	Positive regulation of reticulophagy	IDA	36543799
GO:0140501	Process	Positive regulation of reticulophagy	IMP	32851973
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	16173922
GO:1901798	Process	Positive regulation of signal transduction by p53 class mediator	IDA	16173922
GO:1903052	Process	Positive regulation of proteolysis involved in protein catabolic process	IDA	36543799
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	36121123, 36543799, 37595036, 38383785, 38383789
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IDA	16173922

MIM	HGNC	e!Ensembl
608202	18673	ENSG00000108465

Protein

UniProt ID

Q96JB5

Protein name

CDK5 regulatory subunit-associated protein 3 (CDK5 activator-binding protein C53) (LXXLL/leucine-zipper-containing ARF-binding protein) (Protein HSF-27)

Protein function

Substrate adapter of E3 ligase complexes mediating ufmylation, the covalent attachment of the ubiquitin-like modifier UFM1 to substrate proteins, and which is involved in various processes, such as ribosome recycling and reticulophagy (also call

PDB

8OHD , 8OJ0 , 8OJ5 , 8QFC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05600	DUF773	4 → 503	CDK5 regulatory subunit-associated protein 3	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed (PubMed:10721722, PubMed:12054757). Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Isoform 3 is expressed in kidney, liver, skeletal muscle and placenta (PubMed:12737517).

Sequence

MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSG
SYIHYFHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVR
NVNYEIPSLKKQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELL
ALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYE
WRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES
DSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMEL
EIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHL
FMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTK
ELQKLIEADISKRYSGRPVNLMGTSL

Sequence length

506

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Astrocytoma	Astrocytoma	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	17549666
Breast Neoplasms	Associate	31765941
Carcinoma Hepatocellular	Stimulate	22860085
Colorectal Neoplasms	Stimulate	15457556
Kidney Neoplasms	Inhibit	31061682
Meningeal Carcinomatosis	Associate	17549666
Neoplasms	Associate	17549666, 22860085, 31765941
Neoplasms	Inhibit	19223857, 20164180, 21283629, 29540196, 31061682
Squamous Cell Carcinoma of Head and Neck	Associate	21283629
Stomach Neoplasms	Associate	29540196
Stomach Neoplasms	Inhibit	30228783

CDK5RAP3 (CDK5 regulatory subunit associated protein 3)