Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
8027
Gene name Gene Name - the full gene name approved by the HGNC.
Signal transducing adaptor molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
STAM
Synonyms (NCBI Gene) Gene synonyms aliases
STAM-1, STAM1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p12.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded pr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024512 hsa-miR-215-5p Microarray 19074876
MIRT026819 hsa-miR-192-5p Microarray 19074876
MIRT051525 hsa-let-7e-5p CLASH 23622248
MIRT707233 hsa-miR-3617-5p HITS-CLIP 21572407
MIRT707232 hsa-miR-641 HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 10383417, 16189514, 16730941, 17078930, 17235283, 19111546, 19278655, 20150893, 24790097, 29892012, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005737 Component Cytoplasm IEA
GO:0005768 Component Endosome IEA
GO:0005829 Component Cytosol IDA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601899 11357 ENSG00000136738
Protein
UniProt ID Q92783
Protein name Signal transducing adapter molecule 1 (STAM-1)
Protein function Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involv
PDB 2L0A , 3F1I , 3LDZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00790 VHS 5 139 VHS domain Domain
PF02809 UIM 171 187 Ubiquitin interaction motif Motif
PF00018 SH3_1 216 261 SH3 domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:8780729}.
Sequence
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQG
VTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQ
RQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPS
NFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPAATAAAATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
Sequence length 540
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis
JAK-STAT signaling pathway
  EGFR downregulation
Metalloprotease DUBs
Negative regulation of MET activity
Cargo recognition for clathrin-mediated endocytosis
Clathrin-mediated endocytosis
Endosomal Sorting Complex Required For Transport (ESCRT)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Triple-negative breast cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 28281572
Carcinoma Hepatocellular Associate 38049741
Ependymoma Associate 14578171
Glioblastoma Associate 32065482
Neoplasms Associate 14578171
Uterine Cervical Neoplasms Associate 27581326