TASL (TLR adaptor interacting with endolysosomal SLC15A4)

Gene

• Entrez ID: 80231
• Gene name: TLR adaptor interacting with endolysosomal SLC15A4
• Gene symbol: TASL
• Synonyms (NCBI Gene): CXorf21
• Chromosome: X
• Chromosome location: Xp21.2

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32433612, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0010008	Component	Endosome membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IEA
GO:0034157	Process	Positive regulation of toll-like receptor 7 signaling pathway	IMP	32433612
GO:0034161	Process	Positive regulation of toll-like receptor 8 signaling pathway	IMP	32433612
GO:0035751	Process	Regulation of lysosomal lumen pH	IBA
GO:0035751	Process	Regulation of lysosomal lumen pH	IDA	31001245
GO:0036020	Component	Endolysosome membrane	IDA	32433612
GO:0045087	Process	Innate immune response	IEA
GO:0045089	Process	Positive regulation of innate immune response	IDA	32433612

Other IDs

• MIM: 301049
• HGNC: 25667
• e!Ensembl: ENSG00000120280

Protein

• UniProt ID: Q9HAI6
• Protein name: TLR adapter interacting with SLC15A4 on the lysosome
• Protein function: Innate immune adapter that mediates the recruitment and activation of IRF5 downstream of endolysosomal toll-like receptors TLR7, TLR8 and TLR9 (PubMed:32433612). Following recruitment to endolysosome by SLC15A4 downstream of TLR7, TLR8 and TLR9,
• PDB: 8JZU, 8WX5
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15133	DUF4569	1 → 296	Domain of unknown function (DUF4569)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in immune cell types such as B-cells, neutrophils, dendritic cells and monocytes, the expression levels are two-three-fold higher in female cells compared to male cells (at protein level) (PubMed:31001245, PubMed:31092
• Sequence:

  MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKS
  SGKFISSVHSRESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSI
  CKNYNDLQIAGGQVMAINSVTTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSDFPQKP
  IQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDTVFHDSSPTQIL
  ASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMSTEITEISTPSLHISQYSNVN
  P

• Sequence length: 301