Gene Gene information from NCBI Gene database.
Entrez ID 80196
Gene name Ring finger protein 34
Gene symbol RNF34
Synonyms (NCBI Gene)
CARP-1CARP1RFIRIFRIFFhRFI
Chromosome 12
Chromosome location 12q24.31
Summary The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Ove
miRNA miRNA information provided by mirtarbase database.
371
miRTarBase ID miRNA Experiments Reference
MIRT025100 hsa-miR-181a-5p Sequencing 20371350
MIRT028023 hsa-miR-93-5p Sequencing 20371350
MIRT047982 hsa-miR-30c-5p CLASH 23622248
MIRT046149 hsa-miR-30b-5p CLASH 23622248
MIRT693371 hsa-miR-106a-5p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
GO ID Ontology Definition Evidence Reference
GO:0002039 Function P53 binding IEA
GO:0002039 Function P53 binding IPI 17121812, 18382127
GO:0005515 Function Protein binding IPI 15069192, 22064484, 25416956, 32814053
GO:0005634 Component Nucleus IDA 22064484
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608299 17297 ENSG00000170633
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q969K3
Protein name E3 ubiquitin-protein ligase RNF34 (EC 2.3.2.27) (Caspase regulator CARP1) (Caspases-8 and -10-associated RING finger protein 1) (CARP-1) (FYVE-RING finger protein Momo) (Human RING finger homologous to inhibitor of apoptosis protein) (hRFI) (RING finger p
Protein function E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to n
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13920 zf-C3HC4_3 321 366 Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Detected in heart, brain, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, colon and leukocytes. {ECO:0000269|PubMed:12118383, ECO:0000269|PubMed:15069192}.
Sequence
MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNI
VCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKV
KDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFF
SNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAE
DRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLY
KENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICR
QYVVRA
VHVFKS
Sequence length 372
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of TP53 Degradation
Antigen processing: Ubiquitination & Proteasome degradation