Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8001
Gene name Gene Name - the full gene name approved by the HGNC.	Glycine receptor alpha 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GLRA3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q34.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the ligand-gated ion channel protein family. The encoded protein is a member of the glycine receptor subfamily. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]

Show/Hide all(54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT688096	hsa-miR-4311	HITS-CLIP	23313552
MIRT688095	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT688094	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688093	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT490501	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT490502	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT490500	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT490499	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490498	hsa-miR-9500	PAR-CLIP	23592263
MIRT490497	hsa-miR-5681a	PAR-CLIP	23592263
MIRT490496	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT490495	hsa-miR-4770	PAR-CLIP	23592263
MIRT490494	hsa-miR-6088	PAR-CLIP	23592263
MIRT490493	hsa-miR-6077	PAR-CLIP	23592263
MIRT490492	hsa-miR-3153	PAR-CLIP	23592263
MIRT490490	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490491	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT688096	hsa-miR-4311	HITS-CLIP	23313552
MIRT688095	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT688094	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688093	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT490501	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT490502	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT490500	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT490499	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490498	hsa-miR-9500	PAR-CLIP	23592263
MIRT490497	hsa-miR-5681a	PAR-CLIP	23592263
MIRT490496	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT490495	hsa-miR-4770	PAR-CLIP	23592263
MIRT490494	hsa-miR-6088	PAR-CLIP	23592263
MIRT490493	hsa-miR-6077	PAR-CLIP	23592263
MIRT490492	hsa-miR-3153	PAR-CLIP	23592263
MIRT490490	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490491	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT1021428	hsa-miR-1264	CLIP-seq
MIRT1021429	hsa-miR-155	CLIP-seq
MIRT1021430	hsa-miR-3662	CLIP-seq
MIRT1021431	hsa-miR-4652-3p	CLIP-seq
MIRT1021432	hsa-miR-759	CLIP-seq
MIRT2002656	hsa-miR-4680-5p	CLIP-seq
MIRT2002657	hsa-miR-4799-5p	CLIP-seq
MIRT2002658	hsa-miR-561	CLIP-seq
MIRT2235631	hsa-miR-19a	CLIP-seq
MIRT2235632	hsa-miR-19b	CLIP-seq
MIRT2235633	hsa-miR-297	CLIP-seq
MIRT2235634	hsa-miR-3119	CLIP-seq
MIRT2235635	hsa-miR-3140-3p	CLIP-seq
MIRT2235636	hsa-miR-3149	CLIP-seq
MIRT2235637	hsa-miR-3200-5p	CLIP-seq
MIRT2235638	hsa-miR-4282	CLIP-seq
MIRT2235639	hsa-miR-4682	CLIP-seq
MIRT2388506	hsa-miR-374c	CLIP-seq
MIRT2388507	hsa-miR-4666-3p	CLIP-seq
MIRT2388508	hsa-miR-655	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005231	Function	Excitatory extracellular ligand-gated monoatomic ion channel activity	IBA
GO:0005254	Function	Chloride channel activity	IBA
GO:0005254	Function	Chloride channel activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005886	Component	Plasma membrane	IDA	26416729
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	9677400
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016594	Function	Glycine binding	IEA
GO:0016934	Function	Extracellularly glycine-gated chloride channel activity	IDA	26416729
GO:0016934	Function	Extracellularly glycine-gated chloride channel activity	IEA
GO:0016935	Component	Glycine-gated chloride channel complex	IDA	9677400
GO:0022824	Function	Transmitter-gated monoatomic ion channel activity	IEA
GO:0022852	Function	Glycine-gated chloride ion channel activity	IDA	9677400
GO:0030425	Component	Dendrite	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051260	Process	Protein homooligomerization	IDA	26416729
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098690	Component	Glycinergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA
GO:1902476	Process	Chloride transmembrane transport	IDA	9677400

MIM	HGNC	e!Ensembl
600421	4328	ENSG00000145451

Protein

UniProt ID

O75311

Protein name

Glycine receptor subunit alpha-3

Protein function

Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine (PubMed:26416729, PubMed:9677400). Channel characteristics depend on the subunit composition; heteropentameric channels display faster ch

PDB

5CFB , 5TIN , 5TIO , 5VDH , 5VDI , 9BU2 , 9BU3 , 9BVH , 9BVJ , 9BWB , 9BWC , 9BWE , 9BWG , 9BWJ , 9BZP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	43 → 253	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	260 → 382	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Widely distributed throughout the central nervous system. {ECO:0000269|PubMed:9677400}.

Sequence

MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD

Sequence length

464

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Neurotransmitter receptors and postsynaptic signal transmission

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Autistic Disorder	Associate	15090072
Diabetes Mellitus Type 2	Associate	36949158
Diabetic Nephropathies	Associate	36949158
Hyperekplexia	Associate	28174298
Hyperexplexia hereditary	Associate	28174298
Obesity	Associate	25963547
Stiff Person Syndrome	Associate	28174298

GLRA3 (glycine receptor alpha 3)