Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	8001
Gene name Gene Name - the full gene name approved by the HGNC.	Glycine receptor alpha 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GLRA3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q34.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the ligand-gated ion channel protein family. The encoded protein is a member of the glycine receptor subfamily. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]

Show/Hide all(54)

miRTarBase ID	miRNA	Experiments	Reference
MIRT688096	hsa-miR-4311	HITS-CLIP	23313552
MIRT688095	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT688094	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688093	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT490501	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT490502	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT490500	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT490499	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490498	hsa-miR-9500	PAR-CLIP	23592263
MIRT490497	hsa-miR-5681a	PAR-CLIP	23592263
MIRT490496	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT490495	hsa-miR-4770	PAR-CLIP	23592263
MIRT490494	hsa-miR-6088	PAR-CLIP	23592263
MIRT490493	hsa-miR-6077	PAR-CLIP	23592263
MIRT490492	hsa-miR-3153	PAR-CLIP	23592263
MIRT490490	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490491	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT688096	hsa-miR-4311	HITS-CLIP	23313552
MIRT688095	hsa-miR-6867-5p	HITS-CLIP	23313552
MIRT688094	hsa-miR-6818-5p	HITS-CLIP	23313552
MIRT688093	hsa-miR-574-5p	HITS-CLIP	23313552
MIRT490501	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT490502	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT490500	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT490499	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490498	hsa-miR-9500	PAR-CLIP	23592263
MIRT490497	hsa-miR-5681a	PAR-CLIP	23592263
MIRT490496	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT490495	hsa-miR-4770	PAR-CLIP	23592263
MIRT490494	hsa-miR-6088	PAR-CLIP	23592263
MIRT490493	hsa-miR-6077	PAR-CLIP	23592263
MIRT490492	hsa-miR-3153	PAR-CLIP	23592263
MIRT490490	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490491	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT1021428	hsa-miR-1264	CLIP-seq
MIRT1021429	hsa-miR-155	CLIP-seq
MIRT1021430	hsa-miR-3662	CLIP-seq
MIRT1021431	hsa-miR-4652-3p	CLIP-seq
MIRT1021432	hsa-miR-759	CLIP-seq
MIRT2002656	hsa-miR-4680-5p	CLIP-seq
MIRT2002657	hsa-miR-4799-5p	CLIP-seq
MIRT2002658	hsa-miR-561	CLIP-seq
MIRT2235631	hsa-miR-19a	CLIP-seq
MIRT2235632	hsa-miR-19b	CLIP-seq
MIRT2235633	hsa-miR-297	CLIP-seq
MIRT2235634	hsa-miR-3119	CLIP-seq
MIRT2235635	hsa-miR-3140-3p	CLIP-seq
MIRT2235636	hsa-miR-3149	CLIP-seq
MIRT2235637	hsa-miR-3200-5p	CLIP-seq
MIRT2235638	hsa-miR-4282	CLIP-seq
MIRT2235639	hsa-miR-4682	CLIP-seq
MIRT2388506	hsa-miR-374c	CLIP-seq
MIRT2388507	hsa-miR-4666-3p	CLIP-seq
MIRT2388508	hsa-miR-655	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005254	Function	Chloride channel activity	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	26416729
GO:0005887	Component	Integral component of plasma membrane	IMP	9677400
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0016594	Function	Glycine binding	IBA	21873635
GO:0016934	Function	Extracellularly glycine-gated chloride channel activity	IDA	26416729
GO:0016935	Component	Glycine-gated chloride channel complex	IDA	9677400
GO:0022852	Function	Glycine-gated chloride ion channel activity	IDA	9677400
GO:0030425	Component	Dendrite	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043200	Process	Response to amino acid	IBA	21873635
GO:0043204	Component	Perikaryon	IEA
GO:0045202	Component	Synapse	IBA	21873635
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050877	Process	Nervous system process	IBA	21873635
GO:0051260	Process	Protein homooligomerization	IDA	26416729
GO:0060012	Process	Synaptic transmission, glycinergic	IBA	21873635
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA	21873635
GO:1902476	Process	Chloride transmembrane transport	IDA	9677400

MIM	HGNC	e!Ensembl
600421	4328	ENSG00000145451

Protein

UniProt ID

O75311

Protein name

Glycine receptor subunit alpha-3

Protein function

Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine (PubMed:26416729, PubMed:9677400). Channel characteristics depend on the subunit composition; heteropentameric channels display faster ch

PDB

5CFB , 5TIN , 5TIO , 5VDH , 5VDI , 9BU2 , 9BU3 , 9BVH , 9BVJ , 9BWB , 9BWC , 9BWE , 9BWG , 9BWJ , 9BZP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	43 → 253	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	260 → 382	Neurotransmitter-gated ion-channel transmembrane region	Family

Tissue specificity

TISSUE SPECIFICITY: Widely distributed throughout the central nervous system. {ECO:0000269|PubMed:9677400}.

Sequence

MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD

Sequence length

464

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Neurotransmitter receptors and postsynaptic signal transmission

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	24595857
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	25963547

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Biliary Cholangitis	Biliary Cholangitis			GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Autistic Disorder	Associate	15090072
Diabetes Mellitus Type 2	Associate	36949158
Diabetic Nephropathies	Associate	36949158
Hyperekplexia	Associate	28174298
Hyperexplexia hereditary	Associate	28174298
Obesity	Associate	25963547
Stiff Person Syndrome	Associate	28174298

GLRA3 (glycine receptor alpha 3)