PSCA (prostate stem cell antigen)

Gene

• Entrez ID: 8000
• Gene name: Prostate stem cell antigen
• Gene symbol: PSCA
• Synonyms (NCBI Gene): PRO232, lncPSCA
• Chromosome: 8
• Chromosome location: 8q24.3
• Summary: This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large pro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2305411	hsa-miR-1258	CLIP-seq
MIRT2305412	hsa-miR-1265	CLIP-seq
MIRT2305413	hsa-miR-2392	CLIP-seq
MIRT2305414	hsa-miR-3166	CLIP-seq
MIRT2305415	hsa-miR-4494	CLIP-seq
MIRT2305416	hsa-miR-455-5p	CLIP-seq
MIRT2305417	hsa-miR-4640-5p	CLIP-seq
MIRT2305418	hsa-miR-4726-5p	CLIP-seq
MIRT2305419	hsa-miR-4731-5p	CLIP-seq
MIRT2305420	hsa-miR-4764-5p	CLIP-seq
MIRT2305421	hsa-miR-4802-3p	CLIP-seq
MIRT2305422	hsa-miR-499a-5p	CLIP-seq
MIRT2305423	hsa-miR-651	CLIP-seq
MIRT2305424	hsa-miR-873	CLIP-seq
MIRT2457293	hsa-miR-486-3p	CLIP-seq
MIRT2457294	hsa-miR-661	CLIP-seq
MIRT2457293	hsa-miR-486-3p	CLIP-seq
MIRT2457294	hsa-miR-661	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Unknown	23330817

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9465086
GO:0016020	Component	Membrane	IEA
GO:0030548	Function	Acetylcholine receptor regulator activity	IBA
GO:0033130	Function	Acetylcholine receptor binding	IBA
GO:0033130	Function	Acetylcholine receptor binding	IDA	25680266
GO:0045202	Component	Synapse	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	25680266
GO:0095500	Process	Acetylcholine receptor signaling pathway	IBA
GO:0098552	Component	Side of membrane	IEA
GO:0099601	Process	Regulation of neurotransmitter receptor activity	IDA	25680266

Other IDs

• MIM: 602470
• HGNC: 9500
• e!Ensembl: ENSG00000167653

Protein

• UniProt ID: O43653
• Protein name: Prostate stem cell antigen
• Protein function: May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro. ; May act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inh
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00021	UPAR_LY6	14 → 84	u-PAR/Ly-6 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in prostate (basal, secretory and neuroendocrine epithelium cells). Also found in bladder (transitional epithelium), placenta (trophoblasts), stomach (neuroendocrine cells), colon (neuroendocrine cells) and kidney (col
• Sequence:

  MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLN
  CVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL

• Sequence length: 114

Pathways

Reactome:

Post-translational modification: synthesis of GPI-anchored proteins