Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79957
Gene name Gene Name - the full gene name approved by the HGNC.	Progestin and adipoQ receptor family member 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PAQR6
Synonyms (NCBI Gene) Gene synonyms aliases	PRdelta
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q22

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018303	hsa-miR-335-5p	Microarray	18185580
MIRT029764	hsa-miR-26b-5p	Microarray	19088304
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213503	hsa-miR-1912	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq
MIRT1213507	hsa-miR-501-3p	CLIP-seq
MIRT1213508	hsa-miR-502-3p	CLIP-seq
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq
MIRT2061462	hsa-miR-3180-5p	CLIP-seq
MIRT2061463	hsa-miR-520a-5p	CLIP-seq
MIRT2061464	hsa-miR-525-5p	CLIP-seq
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq
MIRT1213502	hsa-miR-1245b-3p	CLIP-seq
MIRT1213504	hsa-miR-29a	CLIP-seq
MIRT1213505	hsa-miR-29b	CLIP-seq
MIRT1213506	hsa-miR-29c	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA	21873635

MIM	HGNC	e!Ensembl
614579	30132	ENSG00000160781

Protein

UniProt ID

Q6TCH4

Protein name

Membrane progestin receptor delta (mPR delta) (Membrane progesterone P4 receptor delta) (Membrane progesterone receptor delta) (Progesterone and adipoQ receptor family member 6) (Progestin and adipoQ receptor family member 6)

Protein function

Plasma membrane progesterone (P4) receptor coupled to G proteins (PubMed:23161870, PubMed:23763432). Seems to act through a G(s) mediated pathway (PubMed:23161870). Involved in neurosteroid inhibition of apoptosis (PubMed:23161870). May be invol

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03006	HlyIII	43 → 272	Haemolysin-III related	Family

Tissue specificity

TISSUE SPECIFICITY: Brain specific (PubMed:16044242, PubMed:23763432). Highly expressed in the hypothalamus, also expressed in forebrain, amygdala, corpus callosum and spinal cord (PubMed:23161870). {ECO:0000269|PubMed:16044242, ECO:0000269|PubMed:2316187

Sequence

MLSLKLPQLLQVHQVPRVFWEDGIMSGYRRPTSSALDCVLSSFQMTNETVNIWTHFLPTW
YFLWRLLALAGGPGFRAEPYHWPLLVFLLPACLYPFASCCAHTFSSMSPRMRHICYFLDY
GALSLYSLGCAFPYAAYSMPASWLHGHLHQFFVPAAALNSFLCTGLSCYSRFLELESPGL
SKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHLFCALLTGFLFASH
LPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSRRAWLATQEPALGLAGTVA
TLVLAAAGNLLIIAAFTATLLRAPSTCPLLQGGPLEGGTQAKQQ

Sequence length

344

Interactions

View interactions

	KEGG
	Neuroactive ligand-receptor interaction

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Nephronophthisis	NEPHROLITHIASIS, CALCIUM OXALATE	rs62635288, rs267607116, rs201893408, rs267607117, rs202149403, rs118204032, rs121918244, rs750962965, rs1474058708, rs119456959, rs119456960, rs119456961, rs119456962, rs267606916, rs137852856 View all (190 more)	24886237

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	36544231
Carcinoma Renal Cell	Associate	39742277
Endometrial Neoplasms	Inhibit	32733932
Endometriosis	Associate	32733932
Kidney Calculi	Associate	24886237
Neoplasms	Associate	31912669, 34572596, 35064017, 39742277
Osteosarcoma	Associate	40383808
Prostatic Neoplasms	Associate	34572596

PAQR6 (progestin and adipoQ receptor family member 6)