Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	79899
Gene name	Proline rich 5 like
Gene symbol	PRR5L
Synonyms (NCBI Gene)	PROTOR2
Chromosome	11
Chromosome location	11p13-p12

110

Show/Hide all (110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029915	hsa-miR-26b-5p	Microarray	19088304
MIRT497095	hsa-miR-3125	PAR-CLIP	22291592
MIRT497094	hsa-miR-3916	PAR-CLIP	22291592
MIRT497093	hsa-miR-6859-5p	PAR-CLIP	22291592
MIRT497092	hsa-miR-27b-5p	PAR-CLIP	22291592
MIRT497091	hsa-miR-502-5p	PAR-CLIP	22291592
MIRT497095	hsa-miR-3125	PAR-CLIP	22291592
MIRT497094	hsa-miR-3916	PAR-CLIP	22291592
MIRT497093	hsa-miR-6859-5p	PAR-CLIP	22291592
MIRT497092	hsa-miR-27b-5p	PAR-CLIP	22291592
MIRT497091	hsa-miR-502-5p	PAR-CLIP	22291592
MIRT1267154	hsa-miR-1283	CLIP-seq
MIRT1267155	hsa-miR-3545-5p	CLIP-seq
MIRT1267156	hsa-miR-4795-5p	CLIP-seq
MIRT1267157	hsa-miR-520d-5p	CLIP-seq
MIRT1267158	hsa-miR-524-5p	CLIP-seq
MIRT1267159	hsa-miR-1301	CLIP-seq
MIRT1267160	hsa-miR-2115	CLIP-seq
MIRT1267161	hsa-miR-3173-5p	CLIP-seq
MIRT1267162	hsa-miR-3685	CLIP-seq
MIRT1267163	hsa-miR-384	CLIP-seq
MIRT1267164	hsa-miR-4261	CLIP-seq
MIRT1267165	hsa-miR-4660	CLIP-seq
MIRT1267166	hsa-miR-4753-3p	CLIP-seq
MIRT1267167	hsa-miR-490-5p	CLIP-seq
MIRT1267168	hsa-miR-494	CLIP-seq
MIRT1267169	hsa-miR-5047	CLIP-seq
MIRT1267170	hsa-miR-516a-3p	CLIP-seq
MIRT1267171	hsa-miR-543	CLIP-seq
MIRT1267172	hsa-miR-587	CLIP-seq
MIRT2078512	hsa-miR-105	CLIP-seq
MIRT2078513	hsa-miR-1197	CLIP-seq
MIRT2078514	hsa-miR-132	CLIP-seq
MIRT2078515	hsa-miR-140-5p	CLIP-seq
MIRT2078516	hsa-miR-212	CLIP-seq
MIRT2078517	hsa-miR-214	CLIP-seq
MIRT2078518	hsa-miR-3065-3p	CLIP-seq
MIRT2078519	hsa-miR-3619-5p	CLIP-seq
MIRT2078520	hsa-miR-4291	CLIP-seq
MIRT2078521	hsa-miR-4421	CLIP-seq
MIRT2078522	hsa-miR-4477b	CLIP-seq
MIRT2078523	hsa-miR-4738-3p	CLIP-seq
MIRT2078524	hsa-miR-4766-5p	CLIP-seq
MIRT2078525	hsa-miR-4796-3p	CLIP-seq
MIRT2078526	hsa-miR-505	CLIP-seq
MIRT1267170	hsa-miR-516a-3p	CLIP-seq
MIRT2078527	hsa-miR-548t	CLIP-seq
MIRT2078528	hsa-miR-761	CLIP-seq
MIRT2078529	hsa-miR-922	CLIP-seq
MIRT2601923	hsa-miR-1976	CLIP-seq
MIRT2601924	hsa-miR-21	CLIP-seq
MIRT2601925	hsa-miR-3117-5p	CLIP-seq
MIRT2601926	hsa-miR-3658	CLIP-seq
MIRT2601927	hsa-miR-370	CLIP-seq
MIRT2601928	hsa-miR-4755-3p	CLIP-seq
MIRT2601929	hsa-miR-549	CLIP-seq
MIRT2601930	hsa-miR-590-5p	CLIP-seq
MIRT2601931	hsa-miR-665	CLIP-seq
MIRT2601932	hsa-miR-518a-5p	CLIP-seq
MIRT2601933	hsa-miR-527	CLIP-seq
MIRT2688732	hsa-miR-1233	CLIP-seq
MIRT2688733	hsa-miR-124	CLIP-seq
MIRT2688734	hsa-miR-1261	CLIP-seq
MIRT2688735	hsa-miR-1273f	CLIP-seq
MIRT2688736	hsa-miR-190	CLIP-seq
MIRT2688737	hsa-miR-190b	CLIP-seq
MIRT2601923	hsa-miR-1976	CLIP-seq
MIRT2601924	hsa-miR-21	CLIP-seq
MIRT2688738	hsa-miR-2682	CLIP-seq
MIRT2601925	hsa-miR-3117-5p	CLIP-seq
MIRT2688739	hsa-miR-3155	CLIP-seq
MIRT2688740	hsa-miR-3155b	CLIP-seq
MIRT1267161	hsa-miR-3173-5p	CLIP-seq
MIRT2688741	hsa-miR-3201	CLIP-seq
MIRT2601926	hsa-miR-3658	CLIP-seq
MIRT2688742	hsa-miR-3688-3p	CLIP-seq
MIRT2688743	hsa-miR-3689a-3p	CLIP-seq
MIRT2688744	hsa-miR-3689c	CLIP-seq
MIRT2601927	hsa-miR-370	CLIP-seq
MIRT2688745	hsa-miR-3978	CLIP-seq
MIRT2688746	hsa-miR-4269	CLIP-seq
MIRT2688747	hsa-miR-4300	CLIP-seq
MIRT2688748	hsa-miR-4419a	CLIP-seq
MIRT2688749	hsa-miR-4476	CLIP-seq
MIRT2688750	hsa-miR-449c	CLIP-seq
MIRT2688751	hsa-miR-4510	CLIP-seq
MIRT2688752	hsa-miR-4514	CLIP-seq
MIRT2688753	hsa-miR-4663	CLIP-seq
MIRT2688754	hsa-miR-4684-3p	CLIP-seq
MIRT2688755	hsa-miR-4688	CLIP-seq
MIRT2688756	hsa-miR-4692	CLIP-seq
MIRT2688757	hsa-miR-4711-5p	CLIP-seq
MIRT2688758	hsa-miR-4735-5p	CLIP-seq
MIRT2078523	hsa-miR-4738-3p	CLIP-seq
MIRT2688759	hsa-miR-4742-5p	CLIP-seq
MIRT2601928	hsa-miR-4755-3p	CLIP-seq
MIRT2688760	hsa-miR-4768-3p	CLIP-seq
MIRT2688761	hsa-miR-4775	CLIP-seq
MIRT2688762	hsa-miR-4791	CLIP-seq
MIRT2688763	hsa-miR-484	CLIP-seq
MIRT2688764	hsa-miR-506	CLIP-seq
MIRT2601932	hsa-miR-518a-5p	CLIP-seq
MIRT2601933	hsa-miR-527	CLIP-seq
MIRT2601929	hsa-miR-549	CLIP-seq
MIRT2688765	hsa-miR-590-3p	CLIP-seq
MIRT2601930	hsa-miR-590-5p	CLIP-seq
MIRT2688766	hsa-miR-616	CLIP-seq
MIRT2688767	hsa-miR-642a	CLIP-seq
MIRT2601931	hsa-miR-665	CLIP-seq
MIRT2688768	hsa-miR-920	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001933	Process	Negative regulation of protein phosphorylation	IMP	22609986
GO:0005515	Function	Protein binding	IPI	21964062, 32296183
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010762	Process	Regulation of fibroblast migration	IEA
GO:0010762	Process	Regulation of fibroblast migration	IMP	22609986
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22609986
GO:0031932	Component	TORC2 complex	IBA
GO:0031932	Component	TORC2 complex	IDA	22609986
GO:0034599	Process	Cellular response to oxidative stress	IMP	21964062
GO:0038203	Process	TORC2 signaling	IBA
GO:0038203	Process	TORC2 signaling	IDA	22609986
GO:0038203	Process	TORC2 signaling	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0061014	Process	Positive regulation of mRNA catabolic process	IMP	21964062
GO:0090316	Process	Positive regulation of intracellular protein transport	IMP	21964062

MIM	HGNC	e!Ensembl
611728	25878	ENSG00000135362

Q6MZQ0

Protein name

Proline-rich protein 5-like (Protein observed with Rictor-2) (Protor-2)

Protein function

Associates with the mTORC2 complex that regulates cellular processes including survival and organization of the cytoskeleton (PubMed:17461779). Regulates the activity of the mTORC2 complex in a substrate-specific manner preventing for instance t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08539	HbrB	47 → 152	HbrB-like	Domain

Sequence

MTRGFAPILPVEFHKMGSFRRPRPRFMSSPVLSDLPRFQAARQALQLSSSSAWNSVQTAV
INVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQLLAKGLFFVEEKIKLCEGEN
RIEVLAEVWDHFFTETLPTLQAIFYPVQGQELTIRQISLLGFRDLVLLKVKLGDLLLLAQ
SKLPSSIVQMLLILQSVHEPTGPSESYLQLEELVKQVVSPFLGISGDRSFSGPTYTLARR
HSRVRPKVTVLNYASPITAVSRPLNEMVLTPLTEQEGEAYLEKCGSVRRHTVANAHSDIQ
LLAMATMMHSGLGEEASSENKCLLLPPSFPPPHRQCSSEPNITDNPDGLEEGARGSQEGS
ELNCASLS

Sequence length

368

Interactions

View interactions

	KEGG
	mTOR signaling pathway

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Uterine corpus endometrial carcinoma	Uncertain significance	rs141937897	RCV005927250

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Juvenile	Associate	25540605
Breast Neoplasms	Stimulate	27314662
Breast Neoplasms	Associate	27314662
Dermatitis Atopic	Associate	33901562
Drug Hypersensitivity	Associate	29679657

PRR5L (proline rich 5 like)