Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79734
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium channel tetramerization domain containing 17
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCTD17
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to a conserved family of potassium channel tetramerization domain (KCTD)-containing proteins. The encoded protein functions in ciliogenesis by acting as a substrate adaptor for the cullin3-based ubiquitin-conjugati

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs786205860	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017633	hsa-miR-335-5p	Microarray	18185580
MIRT1083008	hsa-miR-1237	CLIP-seq
MIRT1083009	hsa-miR-185	CLIP-seq
MIRT1083010	hsa-miR-3127-3p	CLIP-seq
MIRT1083011	hsa-miR-4306	CLIP-seq
MIRT1083012	hsa-miR-4317	CLIP-seq
MIRT1083013	hsa-miR-4476	CLIP-seq
MIRT1083014	hsa-miR-4501	CLIP-seq
MIRT1083015	hsa-miR-4533	CLIP-seq
MIRT1083016	hsa-miR-4640-5p	CLIP-seq
MIRT1083017	hsa-miR-4644	CLIP-seq
MIRT1083018	hsa-miR-4726-5p	CLIP-seq
MIRT2020737	hsa-let-7a	CLIP-seq
MIRT2020738	hsa-let-7b	CLIP-seq
MIRT2020739	hsa-let-7c	CLIP-seq
MIRT2020740	hsa-let-7d	CLIP-seq
MIRT2020741	hsa-let-7e	CLIP-seq
MIRT2020742	hsa-let-7f	CLIP-seq
MIRT2020743	hsa-let-7g	CLIP-seq
MIRT2020744	hsa-let-7i	CLIP-seq
MIRT2020745	hsa-miR-202	CLIP-seq
MIRT2020746	hsa-miR-224	CLIP-seq
MIRT2020747	hsa-miR-4323	CLIP-seq
MIRT2020748	hsa-miR-4458	CLIP-seq
MIRT2020749	hsa-miR-4500	CLIP-seq
MIRT2020750	hsa-miR-4651	CLIP-seq
MIRT2020751	hsa-miR-4758-3p	CLIP-seq
MIRT2020752	hsa-miR-608	CLIP-seq
MIRT2020753	hsa-miR-98	CLIP-seq
MIRT2252437	hsa-miR-136	CLIP-seq
MIRT1083009	hsa-miR-185	CLIP-seq
MIRT2252438	hsa-miR-1915	CLIP-seq
MIRT2252439	hsa-miR-1972	CLIP-seq
MIRT2252440	hsa-miR-296-5p	CLIP-seq
MIRT2252441	hsa-miR-3140-5p	CLIP-seq
MIRT2252442	hsa-miR-331-3p	CLIP-seq
MIRT2252443	hsa-miR-3664-5p	CLIP-seq
MIRT2252444	hsa-miR-4254	CLIP-seq
MIRT1083011	hsa-miR-4306	CLIP-seq
MIRT2252445	hsa-miR-4308	CLIP-seq
MIRT2252446	hsa-miR-450b-5p	CLIP-seq
MIRT1083017	hsa-miR-4644	CLIP-seq
MIRT2252447	hsa-miR-4714-5p	CLIP-seq
MIRT2252448	hsa-miR-4727-5p	CLIP-seq
MIRT2252449	hsa-miR-4755-3p	CLIP-seq
MIRT2252450	hsa-miR-4769-3p	CLIP-seq
MIRT2252451	hsa-miR-518a-5p	CLIP-seq
MIRT2252452	hsa-miR-527	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21044950, 23455924, 25270598, 25416956, 31515488, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	25983243
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IBA	21873635
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IDA	25270598
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IMP	25983243
GO:0042802	Function	Identical protein binding	IPI	16189514
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	25270598
GO:0045724	Process	Positive regulation of cilium assembly	IBA	21873635
GO:0045724	Process	Positive regulation of cilium assembly	IMP	25270598
GO:0051260	Process	Protein homooligomerization	IEA
GO:0097602	Function	Cullin family protein binding	IBA	21873635
GO:0097602	Function	Cullin family protein binding	IPI	25270598

MIM	HGNC	e!Ensembl
616386	25705	ENSG00000100379

Protein

UniProt ID

Q8N5Z5

Protein name

BTB/POZ domain-containing protein KCTD17

Protein function

Substrate-adapter for CUL3-RING ubiquitin ligase complexes which mediates the ubiquitination and subsequent proteasomal degradation of TCHP, a protein involved in ciliogenesis down-regulation. Thereby, positively regulates ciliogenesis, playing

PDB

5A6R

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02214	BTB_2	33 → 124	BTB/POZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain. Highest expression is observed in the putamen and the thalamus. {ECO:0000269|PubMed:25983243}.

Sequence

MQTPRPAMRMEAGEAAPPAGAGGRAAGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRL
CQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPL
IRIIKDRMEEKDYTVTQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYG
SEDQAEFLCVVSKELHSTPNGLSSESSRKTKSTEEQLEEQQQQEEEVEEVEVEQVQVEAD
AQEKAQSSQDPANLFSLPPLPPPPLPAGGSRPHPLRPEAELAVRASPRPLARPQSCHPCC
YKPEAPGCEAPDHLQGLGVPI

Sequence length

321

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Myoclonic dystonia	Myoclonic dystonia, DYSTONIA 26, MYOCLONIC	rs121908489, rs121908490, rs863223283, rs121908491, rs863223284, rs1584531843, rs121908492, rs863223285, rs398123812, rs786205860, rs794727794, rs886039595, rs1057517990, rs1057519246, rs1189469219 View all (27 more)	25983243

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Mental depression	Depressive disorder	ClinVar
Myoclonic Dystonia	myoclonic dystonia 26	GenCC
Myoclonus-Dystonia Syndrome	myoclonus-dystonia syndrome	GenCC

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Dystonia	Associate	25983243
Myoclonic dystonia	Associate	25983243

KCTD17 (potassium channel tetramerization domain containing 17)