Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79727
Gene name Gene Name - the full gene name approved by the HGNC.
Lin-28 RNA binding posttranscriptional regulator A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LIN28A
Synonyms (NCBI Gene) Gene synonyms aliases
CSDD1, LIN-28, LIN28, ZCCHC1, lin-28A
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRN
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003845 hsa-miR-125b-5p Reporter assay 18230348
Transcription factors
Transcription factor Regulation Reference
KAT2B Unknown 24631505
REST Repression 22532168
SIRT1 Unknown 24631505
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 17617744
GO:0002151 Function G-quadruplex RNA binding ISS
GO:0003723 Function RNA binding IDA 18951094, 19703396
GO:0005515 Function Protein binding IPI 19703396, 21247876, 32296183, 32814053
GO:0005634 Component Nucleus IDA 17617744
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611043 15986 ENSG00000131914
Protein
UniProt ID Q9H9Z2
Protein name Protein lin-28 homolog A (Lin-28A) (Zinc finger CCHC domain-containing protein 1)
Protein function RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism (PubMed:21247876). Seems to recognize a common structural G-quartet (G4) feature i
PDB 2CQF , 2LI8 , 5UDZ , 8OPS , 8OPT , 8OST
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00313 CSD 40 112 Domain
PF00098 zf-CCHC 137 154 Zinc knuckle Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in embryonic stem cells, placenta and testis. Tends to be up-regulated in HER2-overexpressing breast tumors. {ECO:0000269|PubMed:14688391, ECO:0000269|PubMed:15614775, ECO:0000269|PubMed:15722555, ECO:0000269|PubMed:22118463}
Sequence
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGP
GGVFCIGS
ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
GPSAQGKPTYFREEEEEIHSPTLLPEAQN
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transcriptional regulation of pluripotent stem cells
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Associations from Text Mining
Disease Name Relationship Type References
Ameloblastoma Associate 37559082
Atherosclerosis Associate 27230676
Brain Neoplasms Associate 22691720, 31287992
Breast Neoplasms Associate 21912531, 22118463, 22808086, 23840685, 24349438, 26149387, 26460550, 28102845, 32560271, 39849871
Carcinogenesis Associate 23161096, 25503985, 29724816, 29874593, 30531691
Carcinogenesis Inhibit 26080928
Carcinoma Stimulate 22467868
Carcinoma Hepatocellular Associate 22429493, 24475120, 29742265, 33901943, 35955552
Carcinoma Lobular Associate 39849871
Carcinoma Non Small Cell Lung Associate 24780874, 28235063