Gene Gene information from NCBI Gene database.
Entrez ID 79727
Gene name Lin-28 RNA binding posttranscriptional regulator A
Gene symbol LIN28A
Synonyms (NCBI Gene)
CSDD1LIN-28LIN28ZCCHC1lin-28A
Chromosome 1
Chromosome location 1p36.11
Summary This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRN
miRNA miRNA information provided by mirtarbase database.
489
miRTarBase ID miRNA Experiments Reference
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003738 hsa-miR-125a-5p Luciferase reporter assay 17400653
MIRT003845 hsa-miR-125b-5p Reporter assay 18230348
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
KAT2B Unknown 24631505
REST Repression 22532168
SIRT1 Unknown 24631505
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
66
GO ID Ontology Definition Evidence Reference
GO:0000932 Component P-body IDA 17617744
GO:0000932 Component P-body IEA
GO:0002151 Function G-quadruplex RNA binding IEA
GO:0002151 Function G-quadruplex RNA binding ISS
GO:0003676 Function Nucleic acid binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611043 15986 ENSG00000131914
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H9Z2
Protein name Protein lin-28 homolog A (Lin-28A) (Zinc finger CCHC domain-containing protein 1)
Protein function RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism (PubMed:21247876). Seems to recognize a common structural G-quartet (G4) feature i
PDB 2CQF , 2LI8 , 5UDZ , 8OPS , 8OPT , 8OST
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00313 CSD 40 112 Domain
PF00098 zf-CCHC 137 154 Zinc knuckle Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in embryonic stem cells, placenta and testis. Tends to be up-regulated in HER2-overexpressing breast tumors. {ECO:0000269|PubMed:14688391, ECO:0000269|PubMed:15614775, ECO:0000269|PubMed:15722555, ECO:0000269|PubMed:22118463}
Sequence
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGP
GGVFCIGS
ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
GPSAQGKPTYFREEEEEIHSPTLLPEAQN
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transcriptional regulation of pluripotent stem cells