ZNF322 (zinc finger protein 322)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 79692
Gene name Zinc finger protein 322
Gene symbol ZNF322
Synonyms (NCBI Gene)
HCG12ZNF322AZNF388ZNF489
Chromosome 6
Chromosome location 6p22.2
Summary ZNF322A is a member of the zinc-finger transcription factor family and may regulate transcriptional activation in MAPK (see MAPK1; MIM 176948) signaling pathways (Li et al., 2004 [PubMed 15555580]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
miRTarBase ID miRNA Experiments Reference
MIRT042157 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IEA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
610847 23640 ENSG00000181315
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6U7Q0
Protein name Zinc finger protein 322 (Zinc finger protein 322A) (Zinc finger protein 388) (Zinc finger protein 489)
Protein function Transcriptional activator (PubMed:15555580). Important for maintenance of pluripotency in embryonic stem cells (By similarity). Binds directly to the POU5F1 distal enhancer and the NANOG proximal promoter, and enhances expression of both genes (
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 71 → 93 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 127 → 149 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 155 → 177 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 183 → 205 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 211 → 233 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 239 → 261 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 267 → 289 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in heart and skeletal muscle. {ECO:0000269|PubMed:15555580}.
Sequence 
MYTSEEKCNQRTQKRKIYNVCPRKGKKIFIHMHEIIQIDGHIYQCLECKQNFCENLALIM
CERTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRT
HAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGE
KPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHKRVHTGEKPYK
CGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEK
SFNCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSF
HQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS
Sequence length 402
Interactions View interactions