ZNF322 (zinc finger protein 322)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79692
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 322
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF322
Synonyms (NCBI Gene) Gene synonyms aliases
HCG12, ZNF322A, ZNF388, ZNF489
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.2
Summary Summary of gene provided in NCBI Entrez Gene.
ZNF322A is a member of the zinc-finger transcription factor family and may regulate transcriptional activation in MAPK (see MAPK1; MIM 176948) signaling pathways (Li et al., 2004 [PubMed 15555580]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT042157 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000987 Function Cis-regulatory region sequence-specific DNA binding IEA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610847 23640 ENSG00000181315
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6U7Q0
Protein name Zinc finger protein 322 (Zinc finger protein 322A) (Zinc finger protein 388) (Zinc finger protein 489)
Protein function Transcriptional activator (PubMed:15555580). Important for maintenance of pluripotency in embryonic stem cells (By similarity). Binds directly to the POU5F1 distal enhancer and the NANOG proximal promoter, and enhances expression of both genes (
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 71 → 93 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 127 → 149 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 155 → 177 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 183 → 205 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 211 → 233 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 239 → 261 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 267 → 289 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in heart and skeletal muscle. {ECO:0000269|PubMed:15555580}.
Sequence 
MYTSEEKCNQRTQKRKIYNVCPRKGKKIFIHMHEIIQIDGHIYQCLECKQNFCENLALIM
CERTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRT
HAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGE
KPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHKRVHTGEKPYK
CGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEK
SFNCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSF
HQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS
Sequence length 402
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (6)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Dental caries Dental caries N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (6)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 34087420
Autistic Disorder Associate 34087420
Carcinogenesis Associate 26279304, 30258097
Lung Neoplasms Associate 22691236, 26279304, 30258097, 32576196
Neoplasm Metastasis Stimulate 26279304
Neoplasms Associate 22691236, 26279304