ZNF322 (zinc finger protein 322)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79692
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 322
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF322
Synonyms (NCBI Gene) Gene synonyms aliases
HCG12, ZNF322A, ZNF388, ZNF489
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.2
Summary Summary of gene provided in NCBI Entrez Gene.
ZNF322A is a member of the zinc-finger transcription factor family and may regulate transcriptional activation in MAPK (see MAPK1; MIM 176948) signaling pathways (Li et al., 2004 [PubMed 15555580]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT042157 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0005654 Component Nucleoplasm IDA
GO:0005813 Component Centrosome IDA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610847 23640 ENSG00000181315
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q6U7Q0
Protein name Zinc finger protein 322 (Zinc finger protein 322A) (Zinc finger protein 388) (Zinc finger protein 489)
Protein function Transcriptional activator (PubMed:15555580). Important for maintenance of pluripotency in embryonic stem cells (By similarity). Binds directly to the POU5F1 distal enhancer and the NANOG proximal promoter, and enhances expression of both genes (
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 71 → 93 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 127 → 149 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 155 → 177 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 183 → 205 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 211 → 233 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 239 → 261 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 267 → 289 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in heart and skeletal muscle. {ECO:0000269|PubMed:15555580}.
Sequence 
MYTSEEKCNQRTQKRKIYNVCPRKGKKIFIHMHEIIQIDGHIYQCLECKQNFCENLALIM
CERTHTGEKPYKCDMCEKTFVQSSDLTSHQRIHNYEKPYKCSKCEKSFWHHLALSGHQRT
HAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCSECDKCFSRSTNLIRHRRTHTGE
KPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHKRVHTGEKPYK
CGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHTHTFKCLEYEK
SFNCSSDLIVHQRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCDKSF
HQSSALLQHQTVHIGEKPFVCNVSEKGLELSPPHASEASQMS
Sequence length 402
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Lung carcinoma Squamous cell carcinoma of lung rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)		 28604730
Show/Hide Unknown Diseases (6)
Unknown
Disease term Disease name Evidence References Source
Metabolic Syndrome Metabolic Syndrome GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Psoriasis Psoriasis GWAS
Show/Hide Text Mining Associations (6)
Associations from Text Mining
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 34087420
Autistic Disorder Associate 34087420
Carcinogenesis Associate 26279304, 30258097
Lung Neoplasms Associate 22691236, 26279304, 30258097, 32576196
Neoplasm Metastasis Stimulate 26279304
Neoplasms Associate 22691236, 26279304