Gene Gene information from NCBI Gene database.
Entrez ID 79689
Gene name STEAP4 metalloreductase
Gene symbol STEAP4
Synonyms (NCBI Gene)
STAMP2SchLAHTIARPTNFAIP9
Chromosome 7
Chromosome location 7q21.12
Summary The protein encoded by this gene belongs to the STEAP (six transmembrane epithelial antigen of prostate) family, and resides in the golgi apparatus. It functions as a metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1
miRNA miRNA information provided by mirtarbase database.
231
miRTarBase ID miRNA Experiments Reference
MIRT019488 hsa-miR-148b-3p Microarray 17612493
MIRT048618 hsa-miR-99a-5p CLASH 23622248
MIRT644974 hsa-miR-548ac HITS-CLIP 23824327
MIRT644973 hsa-miR-548bb-3p HITS-CLIP 23824327
MIRT644972 hsa-miR-548d-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005768 Component Endosome IBA
GO:0005768 Component Endosome IEA
GO:0005794 Component Golgi apparatus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611098 21923 ENSG00000127954
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q687X5
Protein name Metalloreductase STEAP4 (EC 1.16.1.-) (Six-transmembrane epithelial antigen of prostate 4) (SixTransMembrane protein of prostate 2) (Tumor necrosis factor, alpha-induced protein 9)
Protein function Integral membrane protein that functions as a NADPH-dependent ferric-chelate reductase, using NADPH from one side of the membrane to reduce a Fe(3+) chelate that is bound on the other side of the membrane. Mediates sequential transmembrane elect
PDB 6HCY , 6HD1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03807 F420_oxidored 21 107 NADP oxidoreductase coenzyme F420-dependent Family
PF01794 Ferric_reduct 247 395 Ferric reductase like transmembrane component Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in adipose tissue. Expressed in placenta, lung, heart and prostate. Detected at lower levels in liver, skeletal muscle, pancreas, testis and small intestine. Highly expressed in joints of patients with rheu
Sequence
MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPS
GAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNN
LKINQYPESNAEY
LAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQ
GSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAI
SIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGF
AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFV
LLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCT
AHTLVYGGKRFLSPSNLRWYLPAAY
VLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH
Sequence length 459
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Acute Generalized Exanthematous Pustulosis Stimulate 27884600
★☆☆☆☆
Found in Text Mining only
Arthritis Associate 25683200
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Associate 24105271
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Stimulate 25683200
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Inhibit 32802887
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Type 2 Inhibit 21849520, 28405880
★☆☆☆☆
Found in Text Mining only
Glioma Associate 27898674
★☆☆☆☆
Found in Text Mining only
Head and Neck Neoplasms Inhibit 34344926
★☆☆☆☆
Found in Text Mining only
Heart Failure Associate 25725476
★☆☆☆☆
Found in Text Mining only
Inflammation Inhibit 21849520
★☆☆☆☆
Found in Text Mining only