Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79679
Gene name Gene Name - the full gene name approved by the HGNC.	V-set domain containing T cell activation inhibitor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VTCN1
Synonyms (NCBI Gene) Gene synonyms aliases	B7-H4, B7H4, B7S1, B7X, B7h.5, PRO1291, VCTN1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.1-p12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that hig

Show/Hide all(93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018842	hsa-miR-335-5p	Microarray	18185580
MIRT1488015	hsa-miR-1294	CLIP-seq
MIRT1488016	hsa-miR-3176	CLIP-seq
MIRT1488017	hsa-miR-3662	CLIP-seq
MIRT1488018	hsa-miR-3664-5p	CLIP-seq
MIRT1488019	hsa-miR-3922-3p	CLIP-seq
MIRT1488020	hsa-miR-4259	CLIP-seq
MIRT1488021	hsa-miR-4292	CLIP-seq
MIRT1488022	hsa-miR-4308	CLIP-seq
MIRT1488023	hsa-miR-4316	CLIP-seq
MIRT1488024	hsa-miR-4420	CLIP-seq
MIRT1488025	hsa-miR-4632	CLIP-seq
MIRT1488026	hsa-miR-4715-5p	CLIP-seq
MIRT1488027	hsa-miR-4757-5p	CLIP-seq
MIRT1488028	hsa-miR-4776-3p	CLIP-seq
MIRT1488029	hsa-miR-610	CLIP-seq
MIRT1488030	hsa-miR-660	CLIP-seq
MIRT1488031	hsa-miR-885-5p	CLIP-seq
MIRT2146924	hsa-miR-1225-5p	CLIP-seq
MIRT2146925	hsa-miR-2054	CLIP-seq
MIRT2146926	hsa-miR-3117-5p	CLIP-seq
MIRT2146927	hsa-miR-3132	CLIP-seq
MIRT2146928	hsa-miR-34a	CLIP-seq
MIRT2146929	hsa-miR-34c-5p	CLIP-seq
MIRT2146930	hsa-miR-3713	CLIP-seq
MIRT2146931	hsa-miR-4469	CLIP-seq
MIRT2146932	hsa-miR-449a	CLIP-seq
MIRT2146933	hsa-miR-449b	CLIP-seq
MIRT2146934	hsa-miR-4506	CLIP-seq
MIRT2146935	hsa-miR-4703-3p	CLIP-seq
MIRT2146936	hsa-miR-514	CLIP-seq
MIRT2146937	hsa-miR-514b-3p	CLIP-seq
MIRT2367465	hsa-miR-103a	CLIP-seq
MIRT2367466	hsa-miR-107	CLIP-seq
MIRT2146924	hsa-miR-1225-5p	CLIP-seq
MIRT1488015	hsa-miR-1294	CLIP-seq
MIRT2367467	hsa-miR-1324	CLIP-seq
MIRT2367468	hsa-miR-140-5p	CLIP-seq
MIRT2367469	hsa-miR-15a	CLIP-seq
MIRT2367470	hsa-miR-15b	CLIP-seq
MIRT2367471	hsa-miR-16	CLIP-seq
MIRT2367472	hsa-miR-195	CLIP-seq
MIRT2146925	hsa-miR-2054	CLIP-seq
MIRT2367473	hsa-miR-2682	CLIP-seq
MIRT2146926	hsa-miR-3117-5p	CLIP-seq
MIRT2146927	hsa-miR-3132	CLIP-seq
MIRT2367474	hsa-miR-3150a-3p	CLIP-seq
MIRT2367475	hsa-miR-3166	CLIP-seq
MIRT2367476	hsa-miR-3175	CLIP-seq
MIRT1488016	hsa-miR-3176	CLIP-seq
MIRT2367477	hsa-miR-3179	CLIP-seq
MIRT2367478	hsa-miR-324-5p	CLIP-seq
MIRT2146928	hsa-miR-34a	CLIP-seq
MIRT2146929	hsa-miR-34c-5p	CLIP-seq
MIRT2367479	hsa-miR-3714	CLIP-seq
MIRT2367480	hsa-miR-374c	CLIP-seq
MIRT2367481	hsa-miR-380	CLIP-seq
MIRT2367482	hsa-miR-3915	CLIP-seq
MIRT1488019	hsa-miR-3922-3p	CLIP-seq
MIRT2367483	hsa-miR-3928	CLIP-seq
MIRT2367484	hsa-miR-424	CLIP-seq
MIRT1488021	hsa-miR-4292	CLIP-seq
MIRT1488022	hsa-miR-4308	CLIP-seq
MIRT1488023	hsa-miR-4316	CLIP-seq
MIRT2367485	hsa-miR-4468	CLIP-seq
MIRT2367486	hsa-miR-4476	CLIP-seq
MIRT2146932	hsa-miR-449a	CLIP-seq
MIRT2146933	hsa-miR-449b	CLIP-seq
MIRT2367487	hsa-miR-449c	CLIP-seq
MIRT2146934	hsa-miR-4506	CLIP-seq
MIRT2367488	hsa-miR-4643	CLIP-seq
MIRT2367489	hsa-miR-4699-5p	CLIP-seq
MIRT2146935	hsa-miR-4703-3p	CLIP-seq
MIRT2367490	hsa-miR-4704-3p	CLIP-seq
MIRT2367491	hsa-miR-4709-3p	CLIP-seq
MIRT1488027	hsa-miR-4757-5p	CLIP-seq
MIRT2367492	hsa-miR-4802-3p	CLIP-seq
MIRT2367493	hsa-miR-486-5p	CLIP-seq
MIRT2367494	hsa-miR-497	CLIP-seq
MIRT2146936	hsa-miR-514	CLIP-seq
MIRT2146937	hsa-miR-514b-3p	CLIP-seq
MIRT2367495	hsa-miR-548l	CLIP-seq
MIRT2367496	hsa-miR-642b	CLIP-seq
MIRT2367497	hsa-miR-655	CLIP-seq
MIRT2367498	hsa-miR-665	CLIP-seq
MIRT2367499	hsa-miR-939	CLIP-seq
MIRT2396880	hsa-miR-1827	CLIP-seq
MIRT2396881	hsa-miR-18a	CLIP-seq
MIRT2396882	hsa-miR-18b	CLIP-seq
MIRT2396883	hsa-miR-3907	CLIP-seq
MIRT2396884	hsa-miR-4649-3p	CLIP-seq
MIRT2396885	hsa-miR-4663	CLIP-seq
MIRT2396886	hsa-miR-4735-3p	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001562	Process	Response to protozoan	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005886	Component	Plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IDA	16606666
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IMP	16606666
GO:0043066	Process	Negative regulation of apoptotic process	IMP	15878339
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050868	Process	Negative regulation of T cell activation	IEA
GO:0050868	Process	Negative regulation of T cell activation	IMP	16606666

MIM	HGNC	e!Ensembl
608162	28873	ENSG00000134258

Protein

UniProt ID

Q7Z7D3

Protein name

V-set domain-containing T-cell activation inhibitor 1 (B7 homolog 4) (B7-H4) (B7h.5) (Immune costimulatory protein B7-H4) (Protein B7S1) (T-cell costimulatory molecule B7x)

Protein function

Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together

PDB

4GOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	41 → 147	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level).

Sequence

MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP
DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV
QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV
WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK

Sequence length

282

Interactions

View interactions

	KEGG
	Cell adhesion molecules

VTCN1 (V-set domain containing T cell activation inhibitor 1)