Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	79679
Gene name Gene Name - the full gene name approved by the HGNC.	V-set domain containing T cell activation inhibitor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	VTCN1
Synonyms (NCBI Gene) Gene synonyms aliases	B7-H4, B7H4, B7S1, B7X, B7h.5, PRO1291, VCTN1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.1-p12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that hig

Show/Hide all(93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018842	hsa-miR-335-5p	Microarray	18185580
MIRT1488015	hsa-miR-1294	CLIP-seq
MIRT1488016	hsa-miR-3176	CLIP-seq
MIRT1488017	hsa-miR-3662	CLIP-seq
MIRT1488018	hsa-miR-3664-5p	CLIP-seq
MIRT1488019	hsa-miR-3922-3p	CLIP-seq
MIRT1488020	hsa-miR-4259	CLIP-seq
MIRT1488021	hsa-miR-4292	CLIP-seq
MIRT1488022	hsa-miR-4308	CLIP-seq
MIRT1488023	hsa-miR-4316	CLIP-seq
MIRT1488024	hsa-miR-4420	CLIP-seq
MIRT1488025	hsa-miR-4632	CLIP-seq
MIRT1488026	hsa-miR-4715-5p	CLIP-seq
MIRT1488027	hsa-miR-4757-5p	CLIP-seq
MIRT1488028	hsa-miR-4776-3p	CLIP-seq
MIRT1488029	hsa-miR-610	CLIP-seq
MIRT1488030	hsa-miR-660	CLIP-seq
MIRT1488031	hsa-miR-885-5p	CLIP-seq
MIRT2146924	hsa-miR-1225-5p	CLIP-seq
MIRT2146925	hsa-miR-2054	CLIP-seq
MIRT2146926	hsa-miR-3117-5p	CLIP-seq
MIRT2146927	hsa-miR-3132	CLIP-seq
MIRT2146928	hsa-miR-34a	CLIP-seq
MIRT2146929	hsa-miR-34c-5p	CLIP-seq
MIRT2146930	hsa-miR-3713	CLIP-seq
MIRT2146931	hsa-miR-4469	CLIP-seq
MIRT2146932	hsa-miR-449a	CLIP-seq
MIRT2146933	hsa-miR-449b	CLIP-seq
MIRT2146934	hsa-miR-4506	CLIP-seq
MIRT2146935	hsa-miR-4703-3p	CLIP-seq
MIRT2146936	hsa-miR-514	CLIP-seq
MIRT2146937	hsa-miR-514b-3p	CLIP-seq
MIRT2367465	hsa-miR-103a	CLIP-seq
MIRT2367466	hsa-miR-107	CLIP-seq
MIRT2146924	hsa-miR-1225-5p	CLIP-seq
MIRT1488015	hsa-miR-1294	CLIP-seq
MIRT2367467	hsa-miR-1324	CLIP-seq
MIRT2367468	hsa-miR-140-5p	CLIP-seq
MIRT2367469	hsa-miR-15a	CLIP-seq
MIRT2367470	hsa-miR-15b	CLIP-seq
MIRT2367471	hsa-miR-16	CLIP-seq
MIRT2367472	hsa-miR-195	CLIP-seq
MIRT2146925	hsa-miR-2054	CLIP-seq
MIRT2367473	hsa-miR-2682	CLIP-seq
MIRT2146926	hsa-miR-3117-5p	CLIP-seq
MIRT2146927	hsa-miR-3132	CLIP-seq
MIRT2367474	hsa-miR-3150a-3p	CLIP-seq
MIRT2367475	hsa-miR-3166	CLIP-seq
MIRT2367476	hsa-miR-3175	CLIP-seq
MIRT1488016	hsa-miR-3176	CLIP-seq
MIRT2367477	hsa-miR-3179	CLIP-seq
MIRT2367478	hsa-miR-324-5p	CLIP-seq
MIRT2146928	hsa-miR-34a	CLIP-seq
MIRT2146929	hsa-miR-34c-5p	CLIP-seq
MIRT2367479	hsa-miR-3714	CLIP-seq
MIRT2367480	hsa-miR-374c	CLIP-seq
MIRT2367481	hsa-miR-380	CLIP-seq
MIRT2367482	hsa-miR-3915	CLIP-seq
MIRT1488019	hsa-miR-3922-3p	CLIP-seq
MIRT2367483	hsa-miR-3928	CLIP-seq
MIRT2367484	hsa-miR-424	CLIP-seq
MIRT1488021	hsa-miR-4292	CLIP-seq
MIRT1488022	hsa-miR-4308	CLIP-seq
MIRT1488023	hsa-miR-4316	CLIP-seq
MIRT2367485	hsa-miR-4468	CLIP-seq
MIRT2367486	hsa-miR-4476	CLIP-seq
MIRT2146932	hsa-miR-449a	CLIP-seq
MIRT2146933	hsa-miR-449b	CLIP-seq
MIRT2367487	hsa-miR-449c	CLIP-seq
MIRT2146934	hsa-miR-4506	CLIP-seq
MIRT2367488	hsa-miR-4643	CLIP-seq
MIRT2367489	hsa-miR-4699-5p	CLIP-seq
MIRT2146935	hsa-miR-4703-3p	CLIP-seq
MIRT2367490	hsa-miR-4704-3p	CLIP-seq
MIRT2367491	hsa-miR-4709-3p	CLIP-seq
MIRT1488027	hsa-miR-4757-5p	CLIP-seq
MIRT2367492	hsa-miR-4802-3p	CLIP-seq
MIRT2367493	hsa-miR-486-5p	CLIP-seq
MIRT2367494	hsa-miR-497	CLIP-seq
MIRT2146936	hsa-miR-514	CLIP-seq
MIRT2146937	hsa-miR-514b-3p	CLIP-seq
MIRT2367495	hsa-miR-548l	CLIP-seq
MIRT2367496	hsa-miR-642b	CLIP-seq
MIRT2367497	hsa-miR-655	CLIP-seq
MIRT2367498	hsa-miR-665	CLIP-seq
MIRT2367499	hsa-miR-939	CLIP-seq
MIRT2396880	hsa-miR-1827	CLIP-seq
MIRT2396881	hsa-miR-18a	CLIP-seq
MIRT2396882	hsa-miR-18b	CLIP-seq
MIRT2396883	hsa-miR-3907	CLIP-seq
MIRT2396884	hsa-miR-4649-3p	CLIP-seq
MIRT2396885	hsa-miR-4663	CLIP-seq
MIRT2396886	hsa-miR-4735-3p	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	IBA	21873635
GO:0002250	Process	Adaptive immune response	IEA
GO:0003674	Function	Molecular_function	ND
GO:0005102	Function	Signaling receptor binding	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IDA	16606666
GO:0016021	Component	Integral component of membrane	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IMP	16606666
GO:0043066	Process	Negative regulation of apoptotic process	IMP	15878339
GO:0050852	Process	T cell receptor signaling pathway	IBA	21873635
GO:0050868	Process	Negative regulation of T cell activation	IMP	16606666

MIM	HGNC	e!Ensembl
608162	28873	ENSG00000134258

Protein

UniProt ID

Q7Z7D3

Protein name

V-set domain-containing T-cell activation inhibitor 1 (B7 homolog 4) (B7-H4) (B7h.5) (Immune costimulatory protein B7-H4) (Protein B7S1) (T-cell costimulatory molecule B7x)

Protein function

Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together

PDB

4GOS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	41 → 147	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level).

Sequence

MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP
DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV
QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV
WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK

Sequence length

282

Interactions

View interactions

	KEGG
	Cell adhesion molecules

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19116933

Show/Hide Text Mining Associations (78)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	27438152
Adenocarcinoma of Lung	Associate	27438152, 32372138
Adenomyosis	Associate	34289871
Aortic Aneurysm Familial Abdominal 1	Associate	19903360
Arthritis Juvenile	Associate	19116933, 23152861, 34101054
Biliary Atresia	Associate	40366121
Breast Neoplasms	Associate	19903360, 24125968, 25385143, 28216417, 30486739, 31292534, 32319587, 37294948, 37794509
Breast Neoplasms	Stimulate	35384874
Carcinogenesis	Associate	30813210
Carcinoma Adenoid Cystic	Associate	37256648, 38015043
Carcinoma Basal Cell	Associate	25400757, 29391086
Carcinoma Hepatocellular	Stimulate	26505457
Carcinoma Hepatocellular	Associate	26781180, 27182163, 27750217
Carcinoma Non Small Cell Lung	Associate	22613410, 27440266, 28539467, 31222843
Carcinoma Ovarian Epithelial	Associate	31892360
Carcinoma Pancreatic Ductal	Associate	35862858
Carcinoma Renal Cell	Associate	16798883, 18676826, 18694993, 27292320, 30044793, 32322590
Cholangiocarcinoma	Associate	29235470, 38547421
Colorectal Neoplasms	Associate	23873101, 36980202
Colorectal Neoplasms	Stimulate	26078947, 30363700, 36217128
COVID 19	Associate	36121927
Craniopharyngioma	Associate	32958683
Death	Stimulate	20725832
Death	Associate	27750217, 36217128
Drug Related Side Effects and Adverse Reactions	Associate	19903360
Endometrial Neoplasms	Associate	24658839, 28347512, 33690729, 34158412, 35774278, 36199963, 37873922
Epstein Barr Virus Infections	Associate	20067536
Esophageal Neoplasms	Associate	27764786
Gallbladder Neoplasms	Associate	27874953, 36159808
Glioblastoma	Associate	30159779
Glioma	Stimulate	23327799
Glioma	Associate	32457124
Hepatitis Alcoholic	Associate	40649881
Hepatitis B	Associate	27182163
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	37882675
Hypothyroidism Congenital Nongoitrous 2	Associate	34289871
Infections	Associate	36121927
Inflammation	Associate	33628851
Kidney Neoplasms	Associate	35563753
Laryngeal Neoplasms	Associate	23632869
Lung Neoplasms	Associate	27440266, 29374053, 38219464
Lupus Erythematosus Systemic	Associate	31137925
Lymphatic Metastasis	Associate	19903360, 30363700
Lymphatic Metastasis	Stimulate	20725832, 29235470, 31128028, 34275008, 36217128
Lymphoma B Cell	Associate	20067536
Lymphoma Non Hodgkin	Associate	28246881
Mesothelioma	Associate	36901697
Mesothelioma Malignant	Associate	36901697
Mouth Diseases	Stimulate	34289871
Nasopharyngeal Carcinoma	Associate	31722750
Neoplasm Metastasis	Associate	25954746, 29145206, 31128028, 31703602, 37794509
Neoplasm Metastasis	Stimulate	27750217, 29235470
Neoplasms	Associate	16798883, 18676826, 19903360, 20725832, 23632869, 23803071, 24125968, 24947047, 25385143, 25400757, 25954746, 26505457, 26781180, 27182163, 27292320 View all (32 more)
Neoplasms	Stimulate	23327799, 38015043
Neoplasms Cystic Mucinous and Serous	Associate	27349304
Neuroendocrine Tumors	Associate	35671167
Osteosarcoma	Associate	25954746
Ovarian Neoplasms	Associate	20495537, 27349304, 31128028, 33887301, 36609273, 37882675
Pancreatic Neoplasms	Associate	27750217, 29145206, 35219310, 35624419
Pancreatic Neoplasms	Stimulate	31282407, 33062039
Personality Disorders	Associate	29391086
Pre Eclampsia	Stimulate	39889763
Precancerous Conditions	Associate	34651047
Prostatic Neoplasms	Associate	18042703, 31703602
Salivary Gland Neoplasms	Associate	38015043
Small Cell Lung Carcinoma	Associate	30850021, 32692215
Squamous Cell Carcinoma of Head and Neck	Associate	31089395, 32548602, 32669963
Squamous Cell Carcinoma of Head and Neck	Stimulate	36983005
Stomach Neoplasms	Associate	20725832, 24947047, 25260881, 30813210, 33763491
Thyroid Neoplasms	Associate	23803071
Thyroid Nodule	Associate	27438152
Triple Negative Breast Neoplasms	Associate	35384874
Urethral Neoplasms	Associate	28425229
Urinary Bladder Neoplasms	Associate	28425229, 29391086
Urologic Neoplasms	Associate	34275008
Uterine Cervical Neoplasms	Associate	34651047, 34848831, 35942212
Uterine Cervicitis	Associate	32322590
Uterine Neoplasms	Associate	24658839

VTCN1 (V-set domain containing T cell activation inhibitor 1)