Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79644
Gene name Gene Name - the full gene name approved by the HGNC.
Steroid 5 alpha-reductase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SRD5A3
Synonyms (NCBI Gene) Gene synonyms aliases
CDG1P, CDG1Q, KRIZI, S5AR, S5AR 3, SRD5A2L, SRD5A2L1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CDG1P, CDG1Q
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the steroid 5-alpha reductase family, and polyprenol reductase subfamily. It is involved in the production of androgen 5-alpha-dihydrotestosterone (DHT) from testosterone, and maintenance of the androgen-androge
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs201123766 G>A,C,T Conflicting-interpretations-of-pathogenicity, likely-benign Coding sequence variant, genic upstream transcript variant, synonymous variant
rs267607092 C>A Pathogenic Coding sequence variant, intron variant, stop gained
rs267607093 G>A Pathogenic Coding sequence variant, stop gained
rs267607094 C>A Pathogenic Coding sequence variant, genic upstream transcript variant, stop gained
rs267607095 C>T Pathogenic Coding sequence variant, intron variant, stop gained
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048534 hsa-miR-100-5p CLASH 23622248
MIRT685565 hsa-miR-3928-5p HITS-CLIP 23313552
MIRT685564 hsa-miR-6806-3p HITS-CLIP 23313552
MIRT685563 hsa-miR-6867-5p HITS-CLIP 23313552
MIRT685562 hsa-miR-127-5p HITS-CLIP 23313552
Transcription factors
Transcription factor Regulation Reference
AR Unknown 22194926
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IBA 21873635
GO:0003865 Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity IDA 17986282
GO:0005783 Component Endoplasmic reticulum IBA 21873635
GO:0005783 Component Endoplasmic reticulum IDA 20637498
GO:0005789 Component Endoplasmic reticulum membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611715 25812 ENSG00000128039
Protein
UniProt ID Q9H8P0
Protein name Polyprenal reductase (EC 1.3.1.94) (3-oxo-5-alpha-steroid 4-dehydrogenase 3) (EC 1.3.1.22) (Steroid 5-alpha-reductase 2-like) (Steroid 5-alpha-reductase 3) (S5AR 3) (SR type 3)
Protein function Plays a key role in early steps of protein N-linked glycosylation by being involved in the conversion of polyprenol into dolichol (PubMed:20637498, PubMed:38821050). Acts as a polyprenal reductase that mediates the reduction of polyprenal into d
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02544 Steroid_dh 158 318 3-oxo-5-alpha-steroid 4-dehydrogenase Family
Tissue specificity TISSUE SPECIFICITY: Expressed in preadipocytes (at protein level) (PubMed:26855069). Overexpressed in hormone-refractory prostate cancers (HRPC). Almost no or little expression in normal adult organs. {ECO:0000269|PubMed:17986282, ECO:0000269|PubMed:26855
Sequence
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEP
SRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQF
QGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQ
VPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNH
RIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYK
SKFVSYPKHRKAFLPFLF
Sequence length 318
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Steroid hormone biosynthesis
N-Glycan biosynthesis
Metabolic pathways
  Androgen biosynthesis
Synthesis of Dolichyl-phosphate
Defective SRD5A3 causes SRD5A3-CDG (CDG-1q) and KHRZ
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Anemia Iron-Refractory Iron Deficiency Anemia rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966
View all (89 more)
Antithrombin deficiency Antithrombin III Deficiency rs121909546, rs121909547, rs121909548, rs121909549, rs121909550, rs121909551, rs2227624, rs121909552, rs121909554, rs121909555, rs121909557, rs121909558, rs28929469, rs1572088837, rs121909560
View all (41 more)
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 31358835, 35739271
Breast Neoplasms Stimulate 34465365
Calcinosis Cutis Stimulate 22971343
Carcinoma Hepatocellular Associate 37305349, 39340288
Carcinoma Renal Cell Associate 34958632
Cataract Associate 27480077
Cerebellar Ataxia Associate 20700148, 20852264, 24433453
Cerebellar Diseases Associate 20852264
Cholangiocarcinoma Associate 34871464
Congenital Disorder Of Glycosylation Type In Associate 20700148