Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
79608
Gene name Gene Name - the full gene name approved by the HGNC.
RIC3 acetylcholine receptor chaperone
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RIC3
Synonyms (NCBI Gene) Gene synonyms aliases
AYST720, PRO1385, RIC-3
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the resistance to inhibitors of cholinesterase 3-like family which functions as a chaperone of specific 5-hydroxytryptamine type 3 receptor and nicotinic acetylcholine receptor subtypes. The encoded protein influences the fol
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1306399 hsa-miR-125a-3p CLIP-seq
MIRT1306400 hsa-miR-1266 CLIP-seq
MIRT739891 hsa-miR-2117 CLIP-seq
MIRT739890 hsa-miR-2276 CLIP-seq
MIRT739887 hsa-miR-3145-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0006457 Process Protein folding IEA
GO:0007204 Process Positive regulation of cytosolic calcium ion concentration IEA
GO:0007271 Process Synaptic transmission, cholinergic IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610509 30338 ENSG00000166405
Protein
UniProt ID Q7Z5B4
Protein name Protein RIC-3 (Resistant to inhibitor of cholinesterase 3)
Protein function Molecular chaperone which facilitates proper subunit assembly and surface trafficking of alpha-7 (CHRNA7) and alpha-8 (CHRNA8) nicotinic acetylcholine receptors (PubMed:12821669, PubMed:15504725, PubMed:16120769, PubMed:18691158, PubMed:32204458
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15361 RIC3 15 166 Resistance to inhibitors of cholinesterase homologue 3 Family
Tissue specificity TISSUE SPECIFICITY: Broadly expressed, with high levels in muscle, brain, heart, pancreas and testis. In the central nervous system, highest levels are detected in the cerebellum and pituitary gland. Over-expressed in brains from patients with bipolar dis
Sequence
MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAPSDG
QTPGARFQRSHLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSK
GKTTAEDGKCYTAMPGNTHRKITSFELAQLQEKLKETEAAMEKLIN
RVGPNGESRAQTVT
SDQEKRLLHQLREITRVMKEGKFIDRFSPEKEAEEAPYMEDWEGYPEETYPIYDLSDCIK
RRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESLPTDPRAQEDNSVTSCDPKP
ETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGISTDKAYTGSML
RKRNPQGLE
Sequence length 369
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Unknown
Disease term Disease name Evidence References Source
Movement Disorders movement disorder GenCC
Parkinson disease Parkinson disease GenCC
Associations from Text Mining
Disease Name Relationship Type References
Leukoencephalopathies Associate 23412934
Multiple Sclerosis Associate 23412934
Neoplasms Associate 30914738
Obesity Associate 16443771
Pancreatic Neoplasms Associate 39639217